CloviTrack

Durable task & assignment board · 127 open · last rendered 2026-06-13T19:20:30Z · ledger /root/.clovitek/clovitrack.json

Needs You 5

CT-004 user urgent
Wire Stripe/S3 env-injection (checkout inert fleet-wide)
  • DIAGNOSIS (direct): code is GOOD (clovilegal/routes/billing.js: /checkout, /config, fail-closed webhook). Blockers: (1) Stripe keys NOT injected into app runtime env — pm2 env for clovilegal has ZERO STRIPE vars, so stripe=null and checkout no-ops fleet-wide; (2) NO publishable key (pk_) in master.env -> /config returns null -> frontend can't mount Stripe; (3) NO Price IDs/products in master.env (falls back to inline price_data, OK but not ideal). FIX: inject STRIPE_SECRET+WEBHOOK+PUBLISHABLE into each billing app .env/pm2 ecosystem, restart, register webhook URL in Stripe dashboard. OWNER must provide publishable key + confirm sk is LIVE + create Products/Prices.
billingblocker2026-06-13
CT-005 user urgent
Rotate AWS key (blocks S3 — secrets incident)
awssecurityblocker2026-06-13
CT-006 user high
Provide AppSumo Partner creds
appsumo2026-06-13
CT-007 user medium
Enable a11y daily cron + flip free GCP PSI toggle
a11y2026-06-13
CT-072 claude medium
Redundancy VPS finish
From session coordination board (owner col: —; status col: blocked on user (SSH key console paste))
cross-session-board2026-06-13

In Progress 43

CT-042 claude high
CloviTrack: extensible custom-metric & entity tracking (track anything beyond tasks — ideas from CloviIdea, metrics, experiments, with custom fields/targets)
  • metric/entity model; CloviIdea ideas feed in as a tracked stream
  • Groundwork landed: additive db['metrics'] collection {key,label,value,target,unit,as_of,source} in shared ledger; GET/POST /api/metrics with upsert-by-key; custom metrics render on /kpi. Full custom-entity/field UI still later. Per BUILD_PLAN §4b.
metricsextensible2026-06-13
CT-059 session-b high
Financials: 3-year investor sales plan + per-product P&L (CLOVITEK_3YEAR_INVESTOR_SALES_PLAN.md, *_FINANCIALS.md, pricing_financials.json)
  • [from Session-A] Real bottom-up financials ready — use them: true margin 84.6% (not 78%), real burn $47,343, break-even 117 customers, bootstrap ~$70K. Workbook /root/CLOVITEK_SEO/CloviTek_Investor_Financial_Model.xlsx; ledger CLOVICOST_BOOTSTRAP_LEDGER.md. 2024/2016-2023 LLC P&Ls in Drive (folder 1i-C94y9USFU6YtHS0tlvAgHd9nZFPLxE) to extend history.
  • [Session-A] PER-PRODUCT true margins ready (bottom-up from cost drivers) — drop straight into the per-product P&L: blended 79% (validates the 78% assumption). Range: CloviLeads 90%, CloviFlow 89%, CloviBuild/Scan/Able 86%, CloviLegal 85% ... CloviSEO/Code 75%, CloviNarrate 74%, CloviHuman/PDF 60%, CloviImage 55% (AI+storage heavy). Files: /root/CLOVITEK_SEO/per_product_margins.csv + .png; new tab '5c. Per-Product Margins' in CloviTek_Investor_Financial_Model.xlsx.
financeinvestor2026-06-13
CT-060 session-b high
Investor Portal (INVESTOR_PORTAL_PLAN.md)
investorfinance2026-06-13
CT-061 session-b high
Investor presentation + charts + outreach (CLOVITEK_INVESTOR_PRESENTATION_PLAN.md, investor-charts/, investor-outreach/)
  • [Session-A UI-QC advisor] live findings: Next routes (/ /platforms /pricing /plugins) MISSING canonical (SEO HIGH — add metadataBase+alternates.canonical in app/layout.tsx on next rebuild, CT-074). integrations.html flat/text-heavy (4 visuals / 6k text) — needs rich-visual pass. Homepage amber-dominant (232 amber vs 27 blue) — balance toward Ukrainian blue. Full log: /root/platform-intelligence/learnings/ui_qc_findings.md
investor2026-06-13
CT-070 session-b high
AppSumo pages: green checklists + generated "inside" images + per-product founder/journey section
From session coordination board (owner col: **SESSION-B**; status col: IN PROGRESS (workflow w6b90sph4 = images+green; founder-journey pass queued next))
cross-session-board2026-06-13
CT-073 session-a high
UI/UX + Bug Knowledge RAG (proactive design advisor)
From session coordination board (owner col: **SESSION-A**; status col: **IN PROGRESS (claimed 2026-06-13).** Canonical shared store → `/root/clovitek-engine/var/ui_ux_bug_kb.json` + RAG under `/root/clovitek-engine/rag/`. SESSION-A is feeding THIS session's feedback (widget/a11y/contrast/host-safety/dead-interactive-elements/no-theater/progressive-disclosure) + the `feedback_*.md` memories, bucketed. **SESSION-B: please FEED/CONSUME this same store — do NOT build a competing one.** Goal: agents call `advise(page_type)` before building/redesigning so pages meet standard before the user spots issues.)
  • [Session-A] DONE: proactive UI-QC advisor built (/root/scripts/clovitek_ui_qc_agent.py), cronned daily 08:13 UTC. Scans 8 pages against the 98-rule RAG; detects missing canonical/title/meta/h1, header/footer parity, fragile masked-overlay (yellow-bug pattern), flat/text-heavy pages, amber-dominance. Logs to ui_qc_findings.md. Independently re-caught the integrations-flat + amber-dominant issues the user reported manually = loop proven.
cross-session-board2026-06-13
CT-087 claude high
CloviCost: real expense ledger from Gmail receipts (founder cash-in since 2025) → feeds CT-059 P&L
Crawl Gmail receipts (Anthropic API, Contabo, DataForSEO, AppSumo LTDs, AI subscriptions) since 2025 → structured expense ledger (vendor/amount/date/cadence). Computes EXACT founder cash-in. Real MEASURED data for CloviProof + the CloviFinance design (/root/docs-planning/CLOVIFINANCE_PLATFORM_DESIGN.md). Coordinates with Session-B CT-059 (provides true software/AI COGS) — do NOT duplicate their investor presentation.
  • Session-A. Real measured AI ledger so far: $6.87 Jun2-13 (Anthropic $3.22 of it). Gmail shows 201+ receipt threads since 2025; crawling for exact total.
  • Reframed: founder BOOTSTRAPPING ledger 2015->2026 (CloviFi-era tools -> AppSumo AI-learning era -> 2026 build). MEASURED: 201 Anthropic receipts (all 2026, 1 sampled $215.30), AppSumo LTDs (AiHello Dec2023 + Dialora Oct2025 + Rybbit/Finseo...), DataForSEO $53.82, Manus(free exhausted Apr2026 then paid), Contabo, Jamy. EST total ~$25-50K (Anthropic-dominated). Story beat for CT-059/061: 'invested own money a decade to learn then build.' Ledger: /root/CLOVITEK_SEO/CLOVICOST_BOOTSTRAP_LEDGER.md
  • MEASURED ANCHOR from AppSumo Plus dashboard: 179 deals since 2023, 10% discount saved $3,623.22 => gross ~$36,232, paid ~$32,509. Updated bootstrapping TOTAL ~$60-80K (mid $70K); AppSumo is LARGEST bucket. Chart bootstrap_breakdown.png. Anthropic still needs receipt extraction to pin exact.
  • Manus: started ~Jun2025, only $160 visible in Gmail (Stripe Link); rest on Amex (no email) — EST $300-800. KEY: Amex statement = authoritative source of truth, total is ABOVE $70K Gmail estimate. Manus failed-project refunds (NIR slides 255K cr, PPTX-video 123K cr, AudiobookSmith) = story beat for why he built own engine. RECOMMEND Amex CSV export as primary CloviCost feed.
  • ACCOUNTING-GRADE found in Google Drive: Vital Webmaster LLC 2025 P&L — Computer&Internet $7,064.67 + Dues&Subscriptions $6,777.98 = $13,842.65 software/subs (MEASURED); Total Exp $15,271.53; Net -$15,819.56 (loss=bootstrapping documented). Tax folder '2025-Vitaly-Kimball-Kirkpatrick-Tax-Documents' has full 1099s + IRS notice. Need 2023/2024 P&Ls for multi-year. This is the authoritative feed for CloviCost (beats Gmail).
  • Multi-year tax docs found in Drive 2008->2025; entities Vital Webmaster LLC + UAUSA Holdings LLC. Returns for 2018/2019/2020/2021/2023/2024/2025 available as PDFs. 2025 LLC P&L extracted ($13.8K software). NEXT: extract 2024 return business-expense lines to extend booked software-spend history. 2023 had $66K Robinhood loss (personal). 2025 fed owed ~$237K (Alleviate Tax engaged).
  • [Session-A] REAL-TIME receipt cost tracker BUILT (our own 'SparkReceipt'): parser /root/scripts/clovicost_receipt_parser.py (tested on real Anthropic receipts $215.30+$49.19, dedup OK, provenance MEASURED:email-receipt) + n8n workflow /root/n8n-workflow-exports/clovicost_receipts.json (Gmail broad-receipt trigger->parse->ledger; n8n already running :5678). Tracks ALL SaaS/software receipts (known vendors + domain fallback). Anthropic receipts VARY ($49-$215) so exact total needs full sweep — recommend Amex CSV or n8n history sweep. Spec: docs-planning/CLOVICOST_REALTIME_RECEIPT_TRACKING.md
  • [Session-A] CloviCost now ingests SparkReceipt CSV exports (--csv) with a STRICT CloviTek-software-only filter: allowlist of SaaS vendors + RELEVANT/EXCLUDE keywords, DENY-by-default. Test: 5 software receipts in, 4 unrelated (groceries/fuel/airline/rentals-mortgage) rejected to /root/.clovicost_review.jsonl (never the ledger). User owns SparkReceipt lifetime (no API → use its CSV/Excel export or Make/Zapier). NEED FROM USER: SparkReceipt CSV export (ideally filtered to software/SaaS) dropped on box → exact CloviTek cost total.
  • [Session-A] CloviCost webhook LIVE: pm2 'clovicost-webhook' :8995, nginx https://clovitek.com/clovicost/ (token-gated). SparkReceipt HAS webhooks -> point them here. Tested public POST ingested:true, dup + 401 auth + CloviTek-only filter (groceries rejected) all pass. Recommend n8n (owned, local :5678) over Pabbly/Boost/Albato. URL in /root/.api_keys/clovicost_webhook_token + _port.
  • [Session-A] WORKING SparkReceipt webhook URL (secret-in-path, GET-validation passes, POST ingests, wrong-token=404): https://clovitek.com/clovicost/hook/<token>. Token in /root/.api_keys/clovicost_webhook_token. Both /clovicost/hook/<token> (clean) and /clovicost/sparkreceipt?token= (legacy) live on pm2 clovicost-webhook:8995. User setting up SparkReceipt now.
financialsclovicostprovenance2026-06-13
CT-096 shared high
CloviFinance — NEW TRUE PRODUCT (financial OS: CloviCost/CloviPrice/CloviChannel/CloviUnit/CloviRunway/CloviProject/CloviRaise/CloviProof; provenance spine). Other session ran CloviIdea research + design (CLOVIFINANCE_PLATFORM_DESIGN.md). Internal pricing/investor brain + sellable SaaS.
productclovifinancefinancial2026-06-13
CT-097 claude high
THEN-vs-NOW financial-model velocity proof: 2017 (CPA $2K+ / LivePlan / Startups.co / weeks) vs 2026 (agents / hours / ~$0 / provenance-backed + productized). Data: financial-model-then-vs-now.json
proofvelocityfinancialstoryboard2026-06-13
CT-100 claude high
Investor data-room downloadable materials library (research standard startup-investor checklist; generate one-pager/deck/financial summary/press kit/portfolio/FAQ/NDA/then-vs-now from our REAL data via CloviPDF/CloviDecks; honest real-vs-draft tags) -> wired into Investor Portal + becomes Starter Kit template
investor-portalmaterialsdataroomdownloadsclovipdf2026-06-13
CT-115 claude high
Discovery Agent (reusable): ingests any unstructured folder (local/Drive) -> structured report + manifest + per-topic data streams with links for other agents to consume
discovery-agenttooldrive2026-06-13
CT-116 claude high
Financial TRUTH extraction from Drive folder 1 (CLOVITEK FINANCIAL ANALYSIS_VM.xlsx + PDFs + P&Ls): real actual-vs-projected expenses to accurately fill investor pages/financials; feed financial agent
financialsextractiondrivetruth2026-06-13
CT-117 claude high
Legal+team extraction: previous contracts, LLC->INC transition, who was involved, all team members then (for info)
legalcontractsteamdrive2026-06-13
CT-118 claude high
Product image harvest from Drive folder 2 (1WsX...) + already-extracted presentation image folders -> curated baseline visuals to prettify pages
imagesharvestdrivevisuals2026-06-13
CT-120 claude high
Validate CES 2017 contacts (Drive sheet) + enrich via owned leadgen stack + segment by targeting-fit for new Clovi* products; flag staleness/deliverability/permission
contactsleadgenvalidationtargeting2026-06-13
CT-121 claude high
Legal structuring blueprint THIS time (entity/Articles/Operating-Agreement/bylaws/cap-table/IP-assignment/contractor+NDA/ToS+Privacy/trademark) + DRAFT docs into /root/company-assets/legal via CloviLegal
  • Partially fulfilled: entity-structure report + roadmap written to /root/company-assets/legal/CLOVITEK_ENTITY_STRUCTURE_REPORT.md by Startup Advisor (CT-134). Still need DRAFT docs (IP assignment/CIIAA/SAFE shell/board consents) generated via CloviLegal.
  • Draft docs now exist: IP_TECHNOLOGY_ASSIGNMENT.md, CIIAA.md, BOARD_CONSENT_FORMATION.md, YC_POST_MONEY_SAFE_INSTRUCTIONS.md in /root/company-assets/legal/drafts/. Remaining: Operating Agreement/Certificate, cap table, ToS/Privacy/DPA per product, trademark filings.
legalstructuringcompany-assetsclovilegal2026-06-13
CT-123 claude high
Comprehensive 2015-2022 all-financials sweep (every tax return/P&L/invoice/bank/Amex + Delaware franchise+dissolution costs + Diffco/Chetu dev) -> year-by-year expense reconstruction, provenance-tagged, feeds CT-087 + corrects site numbers
financials2015-2022sweepdelaware2026-06-13
CT-125 claude high
Discovery scan of NEW Drive folder 1_HVz564... (run discovery_agent.py when built) - structured catalog + extract patent/legal invoices (~$40K) + financials + images
discoverydrivepatentfinancials2026-06-13
CT-126 claude high
CloviPatent product research + CloviTek IP SELF-AUDIT (what we can patent/copyright: factory model, getContext, CloviForge, CloviSort, learning loops) + how to start cheaply (provisional/copyright) - RAG basis
clovipatentippatentproductidea2026-06-13
CT-173 claude high
CloviSlider — NEW PRODUCT: intelligent dynamic slide/showcase engine (not static) - features products, auto-promo by visitor interest, effects, A/B + analytics baked in, easy-to-build, composed from all Clovi tools. Prototype=showcase.html + clovi-ab service
productclovisliderslideshowab-testinganalytics2026-06-13
CT-199 claude high
REBUILD CloviCRM via Idea->CloviDOS pipeline: current UI doesnt sell + broken (leftover a11y-widget offers in footer, old cookies, broken UI). Run through CloviIdea (positioning/what-sells) -> feed CloviDOS -> rebuild sellable on-brand UI on the Postgres backend. Founder explicitly wants the full Idea->DOS->business flow
clovicrmrebuildclovidoscloviideapipeline2026-06-13
CT-206 claude high
CloviDOS creative redesign of slider FIRST 4 SLIDES (founder: keep visitors looking) - fix spotlight headline overflow/word-spacing/missing-words (long product copy as giant H1) + '4 tiny thumbnails nobody sees' -> prominent product treatment; story-led, captivating
clovisliderredesignclovidosslides2026-06-13
CT-224 claude high
NOW: code/slide OPTIMIZER plugin (founder 'for now one plugin that optimizes other plugins code or slides') - extend CloviOptimize w/ optimize_code(path): minify JS/CSS + safe perf fixes + image opt; reusable CLI; demo on the slider
clovioptimizecode-optimizerplugin2026-06-13
CT-225 claude high
Homepage CloviContact widget + CloviChat RAG chatbot: multi-channel reach-out (AIO-pattern, license-clean) + chatbot answering CloviTek product/service/business Qs from PUBLIC KB, STRICT no-private-info guardrail (no code/secrets/internal)
clovicontactclovichatchatbotraghomepage2026-06-13
CT-231 claude high
CloviSlider PRODUCT: use anywhere/any site - portable embed (drop-in script, configurable assetBase, CORS) + ADMIN/builder panel (create slides/layers/effects/CTAs, live preview, save config, copy embed snippet) + demo
clovisliderproductembedadminwidget2026-06-13
CT-234 claude high
BUILD semantic internal-linker (CloviOptimize seo_inject part): bge-small zero-cost, server-side; suggest+inject internal links by semantic relevance, right anchor/right place, over-link guards; demo on clovitek.com story+product corpus; launch-gate wire
internal-linkercloviseoclovioptimizeragseo2026-06-13
CT-239 claude high
DOGFOOD: scan clovitek.com + key pages with OUR tools (CloviScan a11y+SEO+vuln, CloviOptimize, CloviAble) -> FIX with our tools -> public REPORT 'scanned & fixed with our own tools' (live demo of dogfooding)
  • Add VISION QC: render homepage to screenshot + LLM-vision critique (layout/overflow/contrast/mobile) ON TOP of CloviScan a11y+SEO+vuln + PSI/Vitals + legal-footer check. Founder ref: gyazo 53ca0edc. Highest-bar pass on SEO/PageSpeed/CWV/safety/legal.
  • DELIVERY: surface the 7 separate reports as a clickable INDICATORS panel (like the live-status green-LEDs) on the page below — each metric = a badge w/ pass/warn/fail color linking to view that report. Public 'we audit ourselves with our own tools' proof. Plus keep full reports for inspection; every FIXLIST item becomes a tracked CloviTrack task for fixing.
  • REUSE EVERYWHERE: expose the 7 audit reports as a reusable embeddable 'proof' widget — show a compact PREVIEW (scorecard badges/LEDs) that expands to the FULL report — and connect it on ALL offering pages (every product/offering page + investors/press), not just the homebase. Single source (story-assets/homepage-qc/) so updates propagate. Demonstrates 'we run our own tools on ourselves' as a selling proof across the fleet.
dogfoodcloviscanclovioptimizescan-fix-report2026-06-13
CT-240 claude high
Investor/Press pages: add floating icons (a11y bottom-left, links-rail middle-right, chat bottom-right) like homepage + add homepage icon to rail; update investor-page logo to homepage CloviTek high-tech logo (clickable->homepage) + investor indicator
investorpressfloating-iconslogo2026-06-13
CT-241 claude high
CloviMarket (NEW product idea, founder): full-stack SEO/marketing for our OWN site first (dogfood) - dynamic keyword research + content optimization (reuse spectroscience content tools) + market-trend-based + admin panel + distribution. Research AppSumo/ProductHunt + OSS + market for the NICHE nobody offers. Study founder FOSS brand-voice files: Drive 1XK58kpBxyvAhiSU9MtQ-1xCdg7ircAJx. + investor-voice RAG (successful-startup-pitch learnings, ground on Shark Tank playbook) so we communicate/evolve better
clovimarketseo-marketingbrand-voiceinvestor-ragresearch2026-06-13
CT-258 claude high
Metrics SYNDICATION plan — tech-metrics.json (CT-257 collector) as a shared source feeding small embeddable widgets across surfaces: per-PRODUCT stats on each platform page (that product's uptime/LOC/build-cost), HOMEPAGE trust strip (fleet totals), PLUGIN/embed metric badges, live-status panel, investor pages. Need a PLACEMENT MAP: which metric -> which surface -> which widget form (counter/badge/chart/LED), with per-product filtering in the JSON. Reuse the CloviSlider embeddable + dogfood proof-widget pattern. Plan deliverable: METRICS_SYNDICATION_PLAN.md (what + where + widget form + data shape).
  • CONFIRMED: reuse as drop-in WIDGETS. Deliverable = a small portable metric-widget embed (same pattern as CloviSlider.mount): <script> + CloviMetrics.mount(el,{metric|group, product?, form:'counter|badge|chart|led', ver}) reading tech-metrics.json from cdn. Per-product filtering keys in the JSON. Widget forms: animated counter, stat badge, mini-chart (CloviCharts), live-status LED, fleet trust-strip. Build the widget lib + dist after engineering.html lands; then place per the map (homepage strip, each platform page's own stats, plugin badges, investor pages).
metricssyndicationwidgetshomepageper-productplan2026-06-13
CT-008 user medium
Give go on CloviLeads redesign when CloviDOS Admin Forge ready
  • Founder green-lit the CloviDOS rebuild path (applied to CRM first)
clovileadsclovidos2026-06-13
CT-010 claude medium
Roll out learning loops: CloviScan, CloviSEO, CloviCode
  • PROGRESS: CloviScan loop scaffolded + run via CloviMind (proves the kit, first step of rollout). `clovimind init cloviscan` generated config+wiring+staged-cron+registry entry + auto-logged CT-047. Config upgraded to real CloviScan corpus (scans.results_json -> issue/remediation docs via cloviscan_scan extractor) + cloviscan_issues miner. `clovimind run cloviscan` indexed 4 real scans w/ bge-small-en-v1.5 via Chroma, mined 18 security-issue patterns, honest confidence tier=early (not yet meaningful at 4 domains), is_learning=true. retrieve() returns cited grounding (cosine 0.80). ecosystem_intel.py already probes /root/scripts/cloviscan_intel_status.py (symlink wiring stub to wire). CloviScan read additively (new /root/cloviscan/data/learned_patterns.json only; existing files untouched). Remaining for CT-010: CloviSEO + CloviCode loops, and symlink-wire the intel probes into /root/scripts. Grounding: A11Y_PERF_HARVESTER_AND_RAG_PLAN.md.
learning-loop2026-06-13
CT-034 claude medium
[w6b90sph4] AppSumo "inside" images + green per-page checklists (task #1).
agent-logsession-2026-06-132026-06-13
CT-071 session-b medium
Chronic restart-loop investigation (clovicrm 494, clovitek-platform 444, spectroscience-site 249)
From session coordination board (owner col: **SESSION-B**; status col: **IN PROGRESS (claimed 2026-06-13)**)
cross-session-board2026-06-13
CT-074 session-b medium
clovitek-site rebuild (.platform-glass-shine fix + Next build)
From session coordination board (owner col: **SESSION-B**; status col: IN PROGRESS — SESSION-A is staying OFF clovitek-site to avoid collision; SESSION-B owns the rebuild+deploy+CDN-purge (which also fixes the /templates stale-chunk). SESSION-A stopped its publish+purge agent 2026-06-13.)
cross-session-board2026-06-13
CT-091 claude medium
the-numbers.html UI-heavy financials page (built, needs nginx whitelist)
financialpageui2026-06-13
CT-092 claude medium
idea-to-profit financial overlay on brain-to-product storyboard (cost->revenue->profit per scene + two flywheels)
pagefinancialstoryboard2026-06-13
CT-093 claude medium
Per-platform build-economics timelines (measured build window+LOC, estimated tokens/cost) - harvester running
financialbuild-economicspage2026-06-13
CT-094 claude medium
Capability showcase + live dogfood demos on pages (embed chat agent, CloviImage-generated art, clickable UI)
pagedogfoodshowcase2026-06-13
CT-172 claude medium
CloviStart = GREEN-LIT as the company/flagship direction (lifecycle:company). Pursue the full startup-launch ecosystem (idea->plan->finance->legal->brand->build->raise->operate). CloviLegal becomes the LEGAL MODULE inside it (not a standalone slog). Founder OS opportunity 58/100; MVP spec next. Reports: founder-hq opportunity-clovistart + strategy-portfolio.
  • P1 handed to other session/CloviDOS (build brief CT-179). Decision: reusable WorkDo module + CloviStart workspace. Session-A keeps designing the funnel + data strategy.
clovistartcompanylifecyclestrategy2026-06-13
CT-208 claude medium
Slider theme DB: also study granular ELEMENTS+ANIMATIONS+INFO+IMAGES per slide and tie 'what works/clicks' to OUR engagement data (clovi-ab A/B + /ab/analytics) - data decides, not opinion
clovislidertheme-dbelementsengagement2026-06-13
CT-228 claude medium
SpectroScience -> ONE universal scientific tool + virtual lab (founder vision): unify all SpectroScience.com knowledge (courses, RAG, glossary, NIR methods, his self-built labs — he once built 'Mobile Lab' for lessons, lost it) into a unified scientific platform w/ chemometrics/calibration + lab. Bigger than CloviSpectra-NIR-only. Discovery running wf_e82ff40b. DELIVERABLE: gather ALL collected NIR-chemometrics info -> a Krisspy-feedable BUILD SPEC doc -> feed Krisspy + CloviDOS with SAME instructions -> compare output/files/visuals + assess MOBILE-APP design quality (new area to explore).
clovispectrascientific-labspectrosciencekrisspyclovidosmobilespec2026-06-13
CT-107 claude low
Session-A cost tracking (2026-06-13)
AI cost this session (Claude Code, Anthropic): ESTIMATE. Workflows: 5 runs, ~1.11M subagent tokens (story+seo 225k, pricing-fin 162k, ux-rag 290k, ext-standards 213k, clovifinance 217k). Plus main-loop (long session). FAL image gen: 13 flux/dev images ~$0.44. Ledger app-spend 06-13: $1.19 (other agents). Rough session Anthropic est: $25-55 (label estimate; exact = Anthropic console). All deliverables logged as CloviTrack done tasks for delivery+cost tracking, mirroring Session-B.
session-acosttracking2026-06-13

Open 79

CT-058 claude high
Wire investor.html + KPI dashboard to consume Session-B's financial model (3-yr plan + pricing_financials.json) = ONE source of truth; link to their investor portal
  • Session-B owns financials; Session-A owns storytelling surface. Numbers must match.
investorfinancecoordination2026-06-13
CT-063 claude high
Shared billing + credit-metering layer
From session coordination board (owner col: —; status col: open (seed = ai_guard ledger per PIL))
cross-session-board2026-06-13
CT-064 claude high
S3 storage adoption fleet-wide
From session coordination board (owner col: —; status col: open)
cross-session-board2026-06-13
CT-065 claude high
Truth-in-product cleanup (overclaims/mocks/vaporware)
From session coordination board (owner col: —; status col: open)
cross-session-board2026-06-13
CT-068 claude high
NeuronWriter playbook infra (roadmap surface, community, review SLA)
From session coordination board (owner col: —; status col: open)
cross-session-board2026-06-13
CT-089 session-b high
Session-B: use Session-A REAL financials (true 84.6% margin, 117-cust break-even, $70K bootstrap) in CT-059/061 — drop the generic 78% assumption
Session-A (CloviCost) produced provenance-backed real numbers. USE THESE in the investor P&L + presentation instead of market assumptions: WORKBOOK: /root/CLOVITEK_SEO/CloviTek_Investor_Financial_Model.xlsx (+ .pdf) — 8 tabs, formula-live. LEDGER: /root/CLOVITEK_SEO/CLOVICOST_BOOTSTRAP_LEDGER.md KEY REAL NUMBERS (replace assumptions): • TRUE contribution margin = 84.6% built bottom-up from ai_guard token ledger (COGS $6.16/cust/mo) — NOT the borrowed 78%. • Real annual cash burn = $47,343 (2025 LLC P&L software/subs $13,843 MEASURED + AI run-rate $30K + hosting + bank fees). • CASH break-even = 117 paying customers (the money-number). • Founder cash-in to date ~$70K (AppSumo $32,509 MEASURED via Plus dashboard; AI APIs ~$30K; 2025 LLC ran $430 revenue / -$15,820 loss = documented bootstrapping). • Cost curve: engine built once -> $2.4K/product at 34, $1K at 100, $650 at 200 (operating leverage). PROVENANCE RULE (CloviProof): tag every figure MEASURED/DERIVED/ASSUMED; Amex statement + filed LLC P&Ls are source of truth. Don't invent numbers.
  • [Session-A] ENTITY SEPARATION: Vital Webmaster LLC = software business (use its P&L: 2025 $13.8K software, -$15.8K). UAUSA Holdings LLC = rental real estate (Form 8825, 'My Utah Rentals') — EXCLUDE from startup P&L. Personal exclusions: Robinhood -$66K 2023, $70,700 police-report loss, Coinbase. Cleanest multi-year software-spend = AppSumo Plus cumulative $32.5K/179 deals + 2025 LLC P&L + 2026 AI run-rate. Don't conflate entities in the investor model.
financialshandoffclovicostprovenance2026-06-13
CT-090 session-b high
Session-B: reuse Session-A real-data visuals in CT-061 investor charts + CT-054 wayback
Charts already generated from REAL data (CloviCost/CloviCharts engine — dogfood proof): • /root/CLOVITEK_SEO/how_did_i_do_that.png — the '~$70K in -> 34 products out' capital-efficiency money-shot (great for Scene-7 flywheel). • /root/CLOVITEK_SEO/bootstrap_breakdown.png — provenance-color-coded cash-in buckets. • Cost-curve + true-margin tabs in the workbook -> redraw as web charts on the financials page. Story beat for CT-054: a decade of investing own money to LEARN (179 AppSumo tools) then BUILD; Manus failed-project refunds (NIR slides 255K cr, PPTX-video, AudiobookSmith) = WHY he built his own engine.
investorchartshandoff2026-06-13
CT-113 claude high
CloviCost multi-source connect (all mailboxes + Amex) + books cleanup support
Connect ALL receipt sources -> CloviCost webhook (live https://clovitek.com/clovicost/). Sources: vitmag@gmail (Gmail/n8n), webmaster@vitalwebmaster.com (Workspace IMAP via SparkReceipt/n8n), vitaly@clovitek.com (VPS BillionMail IMAP — unused yet), Amex (card feed = catch-all for Gmail-missed charges e.g. Manus). Aggregator=SparkReceipt (owned, has webhooks, no API) OR n8n (owned, local). Cheqbook=NO API (QuickBooks/Stripe/PayPal only) — it's the bookkeeping tool for LLC cleanup; CloviCost feeds it the clean software-expense subset. Books cleanup hinges on entity separation: Vital Webmaster LLC=software (include), UAUSA Holdings=rentals (exclude), personal excluded. NEED: SparkReceipt webhook + token wired; Workspace+VPS IMAP creds; pick primary aggregator.
session-aclovicostfinancials2026-06-13
CT-119 claude high
Update investor pages + portals with ACCURATE financials once Drive extraction lands (personal-tax numbers understate; add corporate Inc spend); reframe current totals as 'documented floor, understated'
financialsinvestor-pagesaccuracy2026-06-13
CT-175 claude high
SLIDESHOW BUGS+REQS: not moving/only 1 slide (fix autoplay/Swiper init) + autoplay toggle button + 3D device mockups + layered product screenshots + animated layered cinematic type + realistic app use-cases - DO after CloviSlider engine agent (af1201ca) finishes to avoid clobber
clovisliderbugcinematicautoplay2026-06-13
CT-179 shared high
Startups HQ plan: Operate layer of CloviStart — grow CloviCRM+CloviTrack on CloviStart Postgres core; Perfex/WorkDo = schema reference ONLY (CodeCanyon license forbids SaaS resale); investors+clients = one contact store, two views. Plan: discovery/startups-hq/STARTUPS_HQ_PLAN.md. Build gated on CloviStart multi-tenant core (other session)
startups-hqclovistartcrmclovicrmperfexworkdo2026-06-13
CT-187 session-b high
GREENLIGHT (founder ✅) — CloviCRM → Postgres: PROCEED & FINISH. pg ^8.21.0 already added + migrations/ dir exists (started ~06:09) but server.js still in-memory mock. SCOPE: real Postgres schema + migrations — contacts/leads, pipeline stages-as-ROWS (reorderable), deals, append-only activity_log, notes; persist all CRUD (drop in-memory); multi-tenant-ready (workspace_id). This is the NATIVE CloviStart CRM core shared by Raise (Founders CRM/investors) + Operate (Startups HQ/clients) — investors+clients = one contact store, two views. Feed leads from CloviLeads; activity log = the threaded-record spine. Per CT-179 plan (discovery/startups-hq/STARTUPS_HQ_PLAN.md) + corrected CT-178/180 (build native, NOT WorkDo/Perfex — license). Safe to build now; not gated on Stripe/multi-tenant core for single-tenant v1.
clovicrmpostgresclovistartfounders-crmgreenlight2026-06-13
CT-207 claude high
VALIDATED slider direction (founder likes it): device mockups (laptop+mobile) with the APP CLEARLY VISIBLE on screen = the winning treatment. Lean into it as the backbone across slides; de-emphasize text-only + tiny-thumbnail slides
clovislidervalidateddirectiondevices2026-06-13
CT-210 claude high
Slider 'One engine. Your ___' slide DEFECTS (founder screenshot): (1) 12 fleet tiles are EMPTY dark boxes - need product logo/icon/screenshot inside; (2) big background screen/device is EMPTY - should show a real app screenshot; (3) headline 'Your ___.' missing word (brand/logo placeholder bug). Fix in next pass + eval-harness must flag empty-image tiles (naturalWidth=0)
clovisliderdefectempty-imagesverified2026-06-13
CT-212 claude high
Slider then-vs-now slide refinements (founder): rework TITLE styling; metric SQUARES alignment + bigger description font-size. (Theme DB agrees: this slide under-rendered -> apply count-up numbers + before/after split-wipe)
clovisliderthen-vs-nowtitlealignmentfonts2026-06-13
CT-213 session-b high
CloviDOS BUILD: CloviVision — unified AI image quality inspector & selector. Brief: /root/docs-planning/CLOVIVISION_IMAGE_QC_BUILD_BRIEF.md. ONE service: fetch candidates (Amazon-ASIN-first + OpenLibrary + Unsplash/Pexels keyword + local + generated) -> SCORE each via Claude-vision (generalize audit_cover_images_vendor.py check_image_for_vendor: relevance/sharpness/no-garbled-text/no-wrong-logo/brand-fit -> 0-100 + reject reasons) + deterministic pre-filters -> SELECT best or refuse junk. Integrate into: book covers (ms-studio), page image placement, UI-QC agent (clovitek_ui_qc_agent), stock picking. Reuse gemini_image_guard cost cap. PROVEN: cover_discovery_test validated Amazon-ASIN+vision on B09V2NM74M. Productizable.
  • Stock keys now available: PEXELS_API_KEY + PIXABAY_API_KEY in vault (recovered from WP DB, tested 200). Wire these as the keyword stock-image source adapters.
clovidosclovivisionimage-qcvisionbook-coverbuildhandoff2026-06-13
CT-221 claude high
Place slideshow on HOMEPAGE + logo decision (founder): use homepage logo w/ effect OR CT icon; test slider on clovitek.com homepage. NOTE: homepage=Next app (Session-B owned, hydration-fragile) -> coordinate, careful embed/preview not live-break
sliderhomepageherocoordinate2026-06-13
CT-230 shared high
AI-plugin comparison DONE: aikit/aiomatic/ai-mojo/content-bot = BYO-OpenAI wrappers (only aiomatic has RAG, Pinecone-locked). We WIN on owned RAG+zero-cost embeddings+cost-capped cascade+privacy guardrail. Verdict: CloviAssist (chat+write, one core); gap=drop-in widget+train-on-site. Doc: discovery/ai-chatbot-compare/
cloviassistai-chatbotcomparisonproduct2026-06-13
CT-233 shared high
NytroSEO/dynamic-SEO study: their CSR JS-injection = WEAK (crawlers don't run JS); our edge = SERVER-SIDE delivery. Build 'seo_inject' in CloviOptimize (AI meta+JSON-LD+alt+SEMANTIC internal-linker on bge-small, zero-cost) -> CloviSEO UI -> CloviScan all-in-one. Internal-linker first. Doc: discovery/nytroseo/
cloviseoclovioptimizecloviscandynamic-seointernal-linking2026-06-13
CT-242 claude high
PR team/product (founder): has PR Granger (no API) - study it + AppSumo & other PR + media tools -> products to build (standalone or package). Drive folders: 1NKB4m3J3hWg4UrhJLNQT8kDYRGlLWS0w,1TJO-MiPkjx_wZ5U1mTZdPyZUXv9abeye,1Zr5AHuPSXvQPUpHN8iFmRtwf91MHdP0f,1t_W9qjeeUKI9Mq0_MHIwOSLhscqq-i1f,1tkQeSRENvqWgaQszBTEKP4cTTtHNTtCj,1ugC1lWM_ER141tJyXkuEJUEwDBlmE0u4,1ysOALbKK9CeL0tkucynt9lAYBDDqOxFp. Fold into CloviMarket/CloviPR full-stack marketing
  • MOTIVATION + expense: founder paid Canyon PR ~$10,000 and got a poor job / NO delivered outcomes. Another 'paid pro service that failed' (like $40K patent attys, $2K CPA) -> the case for CloviPR (agents do PR for ~$0). Add to financial reconstruction (PR/marketing category) + the 'professional services replaced by agents' then-vs-now story.
prcloviprclovimarketmediaresearch2026-06-13
CT-243 claude high
Story+financials: add Canyon PR ~$10K-undelivered to (a) financial reconstruction PR/marketing line, (b) the 'professional services replaced by agents' table on then-vs-now/investor pages (CPA $2K->CloviFinance, lawyers $40K->CloviLegal, PR $10K->CloviPR, all delivered nothing -> agents now)
  • FLAGSHIP INVESTOR SELLING TOOL (founder): the 'paid pros who failed me vs my agents now' then-vs-now comparison — CPA $2K, patent attys $40K, Canyon PR $10K = all delivered NOTHING -> CloviFinance/CloviLegal/CloviPR at ~$0. Make it a prominent component on investors.html + the showcase slider. Wire real numbers once Canyon-PR findings (a55964df) land.
storyfinancialscloviprservices-replacedthen-vs-now2026-06-13
CT-244 claude high
Investor component: SEPARATE total-cost THEN-vs-NOW tally - sum of ALL paid efforts (CloviFi ~$175K documented + failed services CPA$2K/patent$40K/CanyonPR$10K) VS NOW (agent fleet ~$0.53/agent, ~$14 for 27 agents this session). Distinct cost-comparison block on investors.html + slider. Use Agent Build Ledger for the 'now' number; honest provenance tags
investorcost-comparisonthen-vs-nowfinancialsflagship2026-06-13
CT-245 shared high
Founder HQ STORYLINE page: personal-experience-driven narrative — founder's hard-won lessons (Canyon PR $10K flop, $40K patent undelivered, $2K CPA, $175K/7yr dissolved company) -> 'so I built these tools' -> founders SIGN UP. Ties the failed-services story to the owned-tools value prop + signup CTA. Coordinate w/ CloviStart/Founder HQ owner (other session); feeds CloviMarket/investor story too
founder-hqclovistartstorylinesignuppersonal-storyflagship2026-06-13
CT-246 shared high
Founder HQ EXPANDED offering (beyond Founders CRM): CRM=spine, but add CloviPR + CloviMarket + CloviScan/CloviOptimize + CloviLegal + CloviFinance + storyline page + 'lessons-learned' playbook (each maps to a hard-won founder lesson/failed-service). Extend FOUNDER_HQ_TOOLKIT.md (the 17-needs->owned-tool->bundle/upgrade map). Coordinate w/ CloviStart owner (other session). Theme: 'everything that cost me $175K the hard way, so founders skip the pain'
founder-hqclovistartofferingcloviprclovimarketexpansion2026-06-13
CT-249 claude high
clovitek-site CRASHLOOP root cause FOUND: PM2 runs 'npm start' (next start) but next.config output:'standalone' -> 'next start does not work with standalone'. 71 restarts. FIX: PM2 exec 'node .next/standalone/server.js' with public/ + .next/static copied beside it (deploy step), OR drop output:standalone. Verify CSS/_next/static still 200 after switch before committing.
clovitek-sitecrashlooppm2standaloneinfra2026-06-13
CT-251 claude high
CloviSlider SMART FIT-TO-VIEWPORT engine (core): slider must measure its ALLOCATED space = viewport height MINUS top nav/menu height (and any chrome) and auto-fit ALL slide content — headline + body + CTAs + media + multi-row grids — so everything is visible with CTAs in view on ANY device (desktop/tablet/mobile). Approach: measure container via ResizeObserver, derive available H = innerHeight - navH - safe-area; fit-to-fit scaling (clamp font + tile sizes), cap grid rows/cols responsively, overflow:hidden on slide never page, re-fit on resize/orientation. From-user-viewpoint: no title/text/CTA ever cut off. Supersedes per-slide overflow patches (CT-250). Founder 2026-06-13
clovisliderfit-to-viewportresponsivesmartcorecta-visible2026-06-13
CT-256 shared high
ARCHITECTURE PRINCIPLE — shared 'CloviCanvas' visual-builder + design-RAG layer: any Clovi product that renders/edits something visual on documents/screen/media (CloviCode, CloviBuilder, CloviSlider, CloviDecks, CloviImage, CloviPDF, DeckSpeaksAI, CloviNarrate, CloviLearn, CloviBrand) REUSES one shared stack: the declarative element/controls registry (from WPBakery/Elementor teardowns), the prebuilt template+effects library, the fit-to-viewport engine, AND the UI/UX Bug RAG + optimization RAG (proactive design advisor) so every builder ships to-standard + self-improves. Build once, consume everywhere. Feeds PLATFORM_DESIGN_BRIEF.md (CT-253).
architectureclovicanvasshared-layerragbuilderreuse2026-06-13
CT-262 shared high
CloviSlider 'One Engine / Your Logo' category slide must match the SIMPLIFIED thumbnail display another Claude session built for home + platform pages. ACTION: find that session's thumbnail simplification (how each product thumb renders on homepage grid + platform pages) and update the slider's category/logo slide + tile rendering (fillCategoryTiles/fillTiles in clovislider.js) to the same simplified treatment (category name + icon, consistent thumb). Coordinate so slider and page grids look unified.
clovisliderthumbnailsone-enginecoordinationconsistency2026-06-13
CT-011 claude medium
CloviDOS next waves: admin component library -> Admin Forge MVP
clovidos2026-06-13
CT-014 claude medium
Wire remaining a11y connection points (getContext antiPatterns, CloviBuild/CloviCode query advise())
a11y2026-06-13
CT-035 claude medium
CloviHuman detect→humanize→re-detect on every AppSumo page + voice-match (task #2) — produces CloviHuman capability scor
agent-logsession-2026-06-132026-06-13
CT-036 claude medium
App-specific CloviTek founder/journey section per page (task #3).
agent-logsession-2026-06-132026-06-13
CT-037 claude medium
Final review/QC + monitoring feedback (task #4).
agent-logsession-2026-06-132026-06-13
CT-043 claude medium
CloviTrack: feed CloviIdea-generated ideas into the board as a tracked idea pipeline
  • track ideas (status: new/exploring/validated/building) alongside projects
ideas2026-06-13
CT-046 claude medium
CloviTrack: PRODUCTIZE — prepare to become a sellable product (multi-tenant, branding, pricing, agent-native PM as the wedge)
  • Phase 5 of CLOVITRACK_PM_BUILD_PLAN; CloviIdea scored it 75/100 Severe-Pain; build great internally first
  • + ALL AGENTS INTEGRATED: whole CloviTek agent fleet (50+ agents + workflow agents) reports into CloviTrack via the agent API (X-Agent-Token) = the command center for the agent ecosystem. Funnel uses agents idea->product. This is the product wedge.
productroadmap2026-06-13
CT-047 claude medium
CloviMind loop for cloviscan (scaffolded)
Linked to CT-010 rollout.
  • Scaffolded via `clovimind init cloviscan` (CloviMind kit, CT-009). Config: /root/clovimind/clovimind/configs/cloviscan.json. Planning doc: /root/docs-planning/A11Y_PERF_HARVESTER_AND_RAG_PLAN.md. Next: edit corpus_sources/miner, run `clovimind run cloviscan`.
clovimindlearning-loop2026-06-13
CT-048 claude medium
CloviPulse Live Map — animated 'brain-wave' ecosystem visualization (idea->agent->plugin->product as a living neural graph, pulses = real CloviPulse activity)
  • FOUNDER INSPIRATION 2026-06-13: CloviDOS-rendered live viz. NOT vaporware — data already exists: CloviIdea ideas + CloviPulse activity feed + CloviTrack funnel stages + agent API. Force-directed/neural graph; nodes=ideas/agents/plugins/products/loops, edges=flow, light-pulses=live events, node-brightness=knowledge growth. = the CloviDOS 'token-graph kernel' hero wired to the REAL ecosystem feed. Build when CloviDOS component lib + CloviMind mature.
visionvisualclovipulseclovidos2026-06-13
CT-053 claude medium
Story-engagement learning loop: instrument story/investor pages to track what resonates (consented analytics) -> finetune the narrative + surface warm-lead signals
  • FOUNDER ETHOS 2026-06-13: 'we don't just give, we live off what we build; we grow and evolve.' Stories become a learning loop like products. Privacy/consent-respecting (our own a11y/privacy standards).
visionstorytellingclovimindengagement2026-06-13
CT-056 claude medium
CloviSense ranker tuning — advise() top-14 saturated by 35 force-included a11y rules; reserve per-bucket slots so founder UI patterns surface in the checklist
clovisenseragtuning2026-06-13
CT-095 claude medium
ENRICHMENT WAVE: after structural pages land, single-owner pass to swap real visuals, wire financial overlay, embed chatbot, make storyboard clickable, add showcase + per-platform timelines; then nginx whitelist + verify + preview links before CDN purge
pageorchestration2026-06-13
CT-128 session-b medium
CloviDOS/platform: bake in REAL-TIME AI spend metering (Anthropic Usage-API poller -> CloviCost)
[from Session-A] Neither session meters its own live token spend; vendor receipts LAG (Anthropic batches recharges, last Jun11). For CloviDOS/platform impl include a real-time spend meter: Anthropic Admin/Usage API poller (needs org Admin API key from user) -> append deltas to CloviCost ledger (/root/.clovicost_receipts.jsonl) every ~5min, provenance MEASURED:anthropic-usage-api; generalize to OpenAI/Gemini/FAL usage APIs. Surface as CloviDOS admin LIVE cost gauge (indicator color spec green/amber/red) + feed CloviRaise real-time COGS. Reuse clovicost_webhook(:8995)+ai_guard caps. Full spec: /root/docs-planning/CLOVICOST_REALTIME_SPEND_METERING.md. USER will confirm inclusion + provide Anthropic Admin key.
clovidosclovicostfinancialshandoff2026-06-13
CT-135 session-b medium
CloviDOS: build full CloviLegal Startup Advisor plugin (productized) — intake -> Legal Roadmap Generator -> Contract Drafting Studio (IP assignment/CIIAA/contractor/NDA/board consent/SAFE shell from CloviLegal 8987 ~160 templates) -> Clause DNA risk review -> Counsel Review workspace w/ attorney-approved gate + native eSign. v1 founder panel already LIVE at clovitek.com/legal-advisor (CT-134). Spec/data: /root/clovilegal-advisor/portal/advisor_data.json. Sellable to other founders + embed in Investor Portal CT-060/data room CT-099.
clovidosclovilegalpluginfundraising2026-06-13
CT-136 claude medium
Idea->Agent->Plugin->Company lifecycle REGISTRY: ensure every concept that graduates (becomes a running agent, a shipped plugin, or a standalone company/product) gets a CloviTrack entry with stage tag [idea|agent|plugin|company], owner, status, and the URL/port/path. Seed from existing: CloviLegal Startup Advisor (plugin, CT-134), CloviCost (agent/plugin), CloviFinance (company). Extends CT-042.
registrygovernancelifecycle2026-06-13
CT-140 shared medium
SHARED REF for other session: AppSumo drafts + landing pages + brand colors index at /root/SHARED_APPSUMO_PRODUCT_INDEX.md. Hubs: clovitek.com/appsumo-review.html, build-showcase.html, recommendations.html. 12 products mapped (draft URL + landing URL + canonical color). Color source: docs-planning/BRAND_COLOR_AUDIT.md.
referenceappsumohandoff2026-06-13
CT-141 shared medium
STORY ARC + 2009 discovery: Wireless(2009, code+hardware) -> WiFi audio(2015-19, code+hardware) -> AI(2026, no code/no hardware, just AI+brains). 2009 UVU project 'Field Surveys on Mobile Devices' = earliest platform DNA (XML dynamic forms + web services + mobile data). Doc /root/clovitek_history_assets/DISCOVERY_2009_FIELD_SURVEYS.md. @session-b: add 2009 era block to wayback.html+about.html+deck CT-061; retrieve+transcode Demonstration.MPG->mp4 for embed.
storyhistoryinvestorhandoff2026-06-13
CT-143 shared medium
Dynamic per-investor portal + owner-panel 360: design done (INVESTOR_PORTAL_DYNAMIC_AND_OWNER_PANEL.json). invest.clovitek.com (pm2 investor-portal:8993) tokenized HMAC links via Sendr/Aimfox -> personalized landing -> gated data room -> CloviLegal eSign NDA -> EOI; per-investor activity tracking + stage machine; 3 separate identity DBs (owner/investor/media); owner sees ALL from platform.clovitek.com via 7 new panel sections. @session-b CT-060.
investor-portalsendrowner-panelhandoff2026-06-13
CT-144 user medium
FREE patent-research API wired: ip_priorart_check.py uses USPTO PatentsView (free). NEEDS YOU: request free PatentsView API key at patentsview.org/api-key -> add PATENTSVIEW_API_KEY to master.env (Search API now key-gated). Then IP agent auto-runs prior-art sweeps per method. Worldwide option: EPO OPS free tier. Founder HQ live at platform.clovitek.com/founder-hq/
ippatentapineeds-you2026-06-13
CT-146 user medium
TM filing strategy (NEEDS YOU/counsel): 1) verify CLOVIFI Reg.5401258 Sec.8/9 maintenance current; 2) file CLOVITEK in Cl.9+42 first; 3) carve CloviCost/CloviFinance out of Cl.36 Clover/Fiserv zone; 4) ITU for unlaunched Clovi* products; 5) attorney full clearance before filing.
trademarkipneeds-you2026-06-13
CT-149 user medium
[ACT-1afa779a18] Lock trade-secret hygiene now — NDAs + IP-assignment for humans AND agents/contractors; keep engines (Conform, factory, RAG, CloviProof, CloviCost) server-side & out of public git. Near-zero c (src:ip-trademark, cat:ops)
actionopspropagated2026-06-13
CT-150 user medium
[ACT-e59579071b] Lock trade-secret hygiene now — NDAs + IP-assignment for humans AND agents/contractors; keep engines (Conform, factory, RAG, CloviProof, CloviCost) server-side & out of public git. Near-zero c (src:ip-trademark, cat:ip)
actionippropagated2026-06-13
CT-151 user medium
[ACT-b0eee1651f] Verify CLOVIFI Reg. 5401258 maintenance — You already own this registered CLOVI mark (filed 2017). Confirm Section 8/9 filings are current so it isn't cancelled. (src:ip-trademark, cat:legal)
actionlegalpropagated2026-06-13
CT-152 user medium
[ACT-7111bb5d65] File CLOVITEK in Class 9 + 42 — House mark appears open; cleanest filing, anchors the Clovi* family. LOW–MEDIUM risk. (src:ip-trademark, cat:legal)
actionlegalpropagated2026-06-13
CT-153 user medium
[ACT-944c6bc5c7] Carve CloviCost/CloviFinance out of Class 36 — Clover/Fiserv own the payments zone (HIGH risk). Keep money products under the CloviTek house mark or draft non-payment IDs. (src:ip-trademark, cat:product)
actionproductpropagated2026-06-13
CT-154 user medium
[ACT-c5419190f8] Copyright-register each engine's source — Conform, factory/getContext, UI/UX RAG, CloviProof, CloviCost — ~$45–65 each, fast protection vs literal copying. (src:ip-trademark, cat:ip)
actionippropagated2026-06-13
CT-155 user medium
[ACT-9fc2cfbf18] File ITU (intent-to-use) for unlaunched Clovi* products — Locks priority now; perfect with Statement of Use at launch. (src:ip-trademark, cat:legal)
actionlegalpropagated2026-06-13
CT-156 user medium
[ACT-52231bceaf] Order full attorney clearance before filing — Warranted specifically because of Clover/Fiserv overlap in your exact classes. (src:ip-trademark, cat:legal)
actionlegalpropagated2026-06-13
CT-157 user medium
[ACT-90690f1bed] Request free PatentsView API key — patentsview.org/api-key → PATENTSVIEW_API_KEY in master.env so the IP agent auto-runs prior-art sweeps. (src:ip-trademark, cat:ops)
actionopspropagated2026-06-13
CT-160 claude medium
Study Perfex CRM (open-source PHP CRM) architecture to model the CloviStart Founders CRM: modules (leads/proposals/contracts/pipeline/kanban), DB schema patterns, role/permission model, what to borrow vs build AI-native. Pair with Foundersuite Investor-CRM kanban teardown.
clovistartcrmresearch2026-06-13
CT-161 user medium
[ACT-4fe60a2307] Wire Stripe + land first paying customers — Single biggest valuation lever — re-rates every method, flips asset story to traction story. (src:valuation, cat:financial)
actionfinancialpropagated2026-06-13
CT-162 user medium
[ACT-31299ed07f] Engage Delaware/Utah startup attorney + CPA — Validate the entity report before acting; budget a ~$5-8K pre-seed prep package. (src:legal-entity, cat:legal)
actionlegalpropagated2026-06-13
CT-163 user medium
[ACT-1051290280] Verify owned-stack readiness — Audit CloviIdea, CloviVenture, CloviDecks, CloviLegal, CloviCost, CloviLeads for production-real (not mocked) status per fleet memory; confirm CloviIdea->CloviV (src:opportunity-clovistart, cat:validation)
actionvalidationpropagated2026-06-13
CT-164 claude medium
[ACT-549d169e66] Build EDGAR DB spine — Stand up the daily Form D / Form C / Form 1-A ingestion + normalization + sector/stage/check tagging job; store with provenance/timestamps. This is the zero-cos (src:opportunity-clovistart, cat:data)
actiondatapropagated2026-06-13
CT-165 claude medium
[ACT-a3abd24270] Define unified founder<->investor record model — Spec the single timeline joining CRM stage + deck-view + SAFE status + cap entry. This shared record IS the differentiator; design it before building UI silos. (src:opportunity-clovistart, cat:architecture)
actionarchitecturepropagated2026-06-13
CT-166 user medium
[ACT-d00803b216] Compliance scaffolding — Draft GDPR legitimate-interest assessment + privacy notice + deletion flow, CAN-SPAM/CASL unsubscribe + sender ID, and 'data+workflow tool, not broker-dealer/fi (src:opportunity-clovistart, cat:legal)
actionlegalpropagated2026-06-13
CT-171 user medium
AppSumo redemption -> tier mapping (NEEDS CT-006 creds): map AppSumo LTD codes to appsumo_tier1/2/3 plans on redemption so paying buyers aren't stuck on 'free'. Also bulk-upgrade existing AppSumo users currently on free (identify via redemption records). Blocked on AppSumo Partner creds.
clovilegalappsumoneeds-you2026-06-13
CT-180 session-b medium
P1 BUILD — Founders CRM as reusable WorkDo module (Raise/Investor) installed into a CloviStart workspace on dash.clovitek.com. Brief: /root/clovistart-research/P1_FOUNDERS_CRM_BUILD_BRIEF.md. Reuse WorkDo Lead/Hrm/Taskly/Account; AI agents wrap (EDGAR feed + Aimfox/Clodura search + Linkila-tracked links + CloviHuman updates); investor=separate Portal surface (hard wall); commitment tracker; CloviLegal SAFE eSign. Acceptance criteria + inputs in brief. Vitaly uses for own raise (no Stripe dependency). Decided CT-178.
  • CORRECTED + ALIGNED with CT-179 (other session): do NOT build as a WorkDo module — CodeCanyon license forbids SaaS resale (perfex_saas multi-tenant exceeds Regular license). BUILD NATIVE: grow CloviCRM + CloviTrack on the CloviStart Postgres core; WorkDo/Perfex/ERPGo = SCHEMA REFERENCE ONLY + personal back-office. Founders CRM (Raise) + Startups HQ (Operate) share ONE Postgres contact/activity core, two views. Supersedes the WorkDo-kernel approach in CT-178.
  • Implementation track = CloviCRM->Postgres (new greenlight task, owner session-b). P1 Founders CRM = the Raise VIEW on that native Postgres CRM core; this brief's investor schema (raises/stages/investor_activity/commitments) layers on top.
clovistartfounders-crmworkdoP1handoffbuild2026-06-13
CT-198 claude medium
LayerSlider had good TEMPLATES too - extract/learn the template designs (proprietary->recreate as CloviSlider presets/templates, ship none of their code)
clovislidertemplates2026-06-13
CT-209 claude medium
NAMING DECISION: the Founder OS = 'CloviFounder' (was CloviStart). Clearer/more recognizable — says who it's for. Adopt going forward; full rename across pages/docs/CRM = follow-up sweep (CloviStart references in investors.html, opportunity report, specs, value indicator). lifecycle:company.
clovifoundernamingrenameclovistart2026-06-13
CT-216 user medium
SECURITY (low-pri): vitalwebmaster_wp DB scan surfaced a live OpenAI key (sk-nFQ3...) in aiomatic_Main_Settings app_id + assorted plugin API keys (eway/zapier/uaf). Consider rotating the OpenAI key + auditing plugin-stored secrets. Found while recovering Pexels/Pixabay.
securitysecretswordpressvitalwebmaster2026-06-13
CT-223 shared medium
STRATEGY (founder, CloviIdea to present): CloviOptimize as a plugin usable on any site; consolidate CloviAble(a11y)+CloviSEO+CloviScanner+perf INTO CloviScan as all-in-one site-quality product
clovioptimizecloviscanstrategyproduct2026-06-13
CT-229 claude medium
SpectroScience course expansion -> practical/professional focus: add SOPs, tutorials, hands-on procedures for industry professionals (not just theory). Feeds the unified scientific-lab tool + the practical content library.
spectrosciencecoursesopscontent2026-06-13
CT-235 claude medium
Accuracy follow-up (MED/LOW from sweep): reconcile product-count drift across pages (investors '38 platforms'/'50-100 products', the-numbers '38 products' -> canonical ~40 products / ~12 Tier-1, mark 50-100 as roadmap). Verify launch-ready list. No revenue/customer over-claims found (honest tone intact).
accuracyproduct-countpages2026-06-13
CT-252 shared medium
OFFERING/MOAT — CloviSlider 'Smart Layered Player' differentiator: unlike LayerSlider/Slider Revolution/Smart Slider (fixed-canvas, content clips/overflows on real viewports), CloviSlider AUTO-FITS to allocated space (viewport - nav - safe-area), titles+text+CTAs visible on ANY device (CT-251). AND it EVOLVES: every caught UI issue feeds the UI/UX Bug RAG -> the engine self-improves (fit logic, overflow rules, a11y) release over release, vs a frozen plugin. Sell as (a) standalone embeddable product (dist+admin builder built), (b) value-add in Founder HQ/CloviMarket, (c) live demo proof 'we fix what static header slideshows cant — and keep learning'. Position self-fitting + self-evolving as headline features nobody else offers.
clovisliderofferingmoatdifferentiatorself-evolvingrag2026-06-13
CT-259 claude medium
Floating action labels missing space: 'Chat with us'+following text run together (no space) on the chat 'Get in touch' widget AND the other two rail actions — JSX/text-node whitespace bug in SideRail.tsx / CloviContact widget. Fix after the hero+overlay deploy.
homepagesiderailspacingbug2026-06-13
CT-260 claude medium
CloviSlider: make clicking the hero advance to next slide (click-anywhere->next, but ignore clicks on CTAs/links/buttons). Add to clovislider.js engine + cursor:pointer affordance. Founder request.
clovislideruxclick-advance2026-06-13
CT-263 claude medium
CloviSlider DEFAULT effect = 'CloviTek Signature' blend (chosen for science+tech+AI brand, CWV-safe, from report 09): aurora gradient mesh backdrop (indigo->cyan = AI/data) + soft god-rays + slow sheen sweep on device (optical/science cue) + subtle parallax depth + 3D tilt on laptop + ~4% film grain + vignette + gradient-shimmer text reveal; OPTIONAL faint constellation/node lines (AI-network, kept very subtle). AVOID confetti/neon/VHS/glitch/heavy-flare. transform+opacity only, reduced-motion-safe. Implement as composable EffectLayers in LayerTimeline.
clovislidereffectssignaturecinematicdefault2026-06-13
CT-012 claude low
Check what the clovilearn PM2 process is
ops2026-06-13
CT-013 claude low
Fix CloviIdea market-trends stub
cloviidea2026-06-13
CT-055 claude low
Ops: two nginx masters on box — aaPanel reload hits wrong PID file (real master 1345990 needs kill -HUP); investigate/clean up
opsnginxselfheal2026-06-13

Blocked 0

— none —

Done 129

CT-001 claude high
CloviLeads rebuild
  • DONE: real lead discovery default (Clodura), enrichment+verify, credit metering+402, UI conform (indigo/Lucide/collapsible/inline-modals), outreach dry-run-safe (no real sends), marketing honesty pass
clovileads2026-06-13
CT-009 claude high
Extract CloviMind from the 3 prototype loops
  • All 3 prototypes proven (CloviAble/CloviIdea/CloviLegal) -> extracting the reusable kit now
  • CloviMind kit BUILT + VERIFIED at /root/clovimind. Extracted from 3 proven loops (CloviAble/CloviIdea/CloviLegal): embedder.py (byte-identical extract), loop.py (configurable LearningLoop: ingest->index->learn->derived-store->intel->reembed, named EXTRACTORS+MINERS, auto-scaling confidence flip), retrieve.py (retrieve+grounding_block w/ citations), intel.py (uniform build_status + registry), cli.py (init/run/index/learn/status/retrieve/list). registry.json seeds all 3 + cloviscan. ECOSYSTEM_FEED.md documents CloviSense+PIL feed. 3 originals NOT refactored (run as-is; can adopt shared lib later). Planning grounding: A11Y_PERF_HARVESTER_AND_RAG_PLAN.md + CLOVILEGAL_ATTORNEY_GRADE_ELEVATION.md + PIL doc + project_clovimind_ecosystem_learning.
clovimindlearning-loop2026-06-13
CT-022 claude high
CloviTrack: durable assignment tracker (ledger+CLI+dashboard+brief wiring)
  • live at clovitek.com/clovitrack.html; auto-shows in session brief
2026-06-13
CT-023 claude high
CloviTrack PM tool: research + CloviIdea-generated build plan (study WorkDo + vitalwebmaster PHP CRM)
  • DONE: build plan at CLOVITRACK_PM_BUILD_PLAN.md; CloviIdea ran (75/100); learned from WorkDo Taskly + Perfex CRM (polymorphic linking); prefill from 102 project_*.md + 309 specs + registry
2026-06-13
CT-024 claude high
Build real CloviTrack PM app (importer/prefill + track.clovitek.com Flask app: board/calendar/Gantt + agent API)
  • Built: importer (102 projects/14 tasks imported), track.clovitek.com Flask app live (PM2 clovitrack:8977), board/projects/calendar/timeline/agents views, agent REST API, SSO-gated, CLI+ledger shared.
  • LIVE: track.clovitek.com (SSO-gated). 102 projects prefilled from memory + 243 docs linked + 240 services matched. 5 views (board/projects/calendar/timeline/agents). Agent API (X-Agent-Token) verified. Shared ledger w/ CLI.
2026-06-13
CT-039 claude high
Live feedback to PM admin: ecosystem-intelligence aggregator (self-evolving systems' knowledge growth + agent activity + real analytics)
  • DONE: CloviPulse aggregator — ecosystem_intel.json (systems growth + activity + real analytics), HTML render, staged cron, CloviTrack integration contract. CloviAble+CloviIdea LIVE, others pending. clovianalytics=mock flagged.
2026-06-13
CT-041 claude high
CloviTrack: KPI / performance statistics dashboard (overall + per-product KPIs with targets; tasks/week, products shipped, intel growth, services grade, AppSumo-ready count, revenue when live)
  • extends CT-039 aggregator's real-analytics; build into the app after CT-024 lands
  • Built /kpi (KPI & Intel). Reads /root/.clovitek/ecosystem_intel.json (CloviPulse). Real KPIs w/ targets+progress bars: tasks done/recent, services 61/61, registry 240, intel corpus 224/18 patterns, autofix 13. Pending-real-data tiles (products shipped/revenue/signups) shown honestly; clovianalytics=MOCK flag rendered verbatim. Self-evolving systems cards w/ growth delta + sparkline from history.jsonl. Live agent activity feed (40). Per INTEGRATION.md contract.
kpianalytics2026-06-13
CT-044 claude high
CloviTrack: Idea Funnel view — the 'crazy ideas bucket' from CloviIdea flowing idea->exploring->validated->building->shipped(product)
  • pull generated ideas from CloviIdea; funnel pipeline to products
  • Built /funnel: Ideas→Exploring→Validated→Building→Shipped. Pulls real CloviIdea ideas (ideas.db, read-only) via sources.load_ideas/funnel; stages by score(≥75 validated,≥50 exploring) + product-link; CloviTrack product-projects flow through building(27)/shipped(10). Honest corpus note (11 ideas, 4 early agent-dumps). Idea cards clickable→detail. Per BUILD_PLAN §4c.
ideasfunnel2026-06-13
CT-045 claude high
CloviTrack: drill-down detail pages — click any project/system/idea to view its full CloviTrack detail (tasks, status, linked docs/services/health, related)
  • Built client-routed drill-down detail pages (/detail/{project|idea|system}/<id>) via /api/detail/*. Project→tasks/status/linked docs+service+health/related ideas/system intel; Idea→score/market/why-now + product it became; System→CloviPulse corpus/patterns/confidence + growth sparkline. Project/idea/system/board-task cards all link to detail. Per BUILD_PLAN §4c + ecosystem_intel.INTEGRATION.md.
uxdrilldown2026-06-13
CT-049 claude high
clovitek.com 'How It Works' page — animated ecosystem flow (idea->agent->plugin->product brain-wave viz) powered by live CloviPulse data
marketingvisualpage2026-06-13
CT-050 claude high
clovitek.com Investor Pitch page — animated visuals + REAL data (products/agents/intelligence/velocity; HONEST pre-revenue, no fabricated traction)
investormarketingpage2026-06-13
CT-051 claude high
Brainstorm panel: 'any idea -> mobile app / sellable product' via CloviDOS ecosystem (3 agents, diverse lenses, then synthesize)
  • DONE: 3 brainstorm lenses (story+storyboard, mobile, sells+moat) synthesized into 99_SYNTHESIS.md. Thesis + 8-scene journey + Scene-7 money-shot + honesty ledger. Feeds CT-049/050.
visionbrainstormclovidos2026-06-13
CT-052 claude high
Ingest founder-provided UI reference materials (step-by-step UI docs + interface screenshots in /root) -> extract patterns -> feed CloviSense design RAG
  • CT-052 complete. Inventoried 19 founder 'Stepsy' .docx UI walkthroughs + 1 a11y screenshot zip in /root. 8 .docx were empty 6480-byte stubs (NOISE: Closely/GoPDF/Labrika/Kanbox/SleekBio/ElkQR/2x Accessibility-Dashboard + the 128-step zip = competitor screenshot tour, low value). 11 .docx had real screenshots+step captions (Domexus, Odin AI, Greta, Presenti, Ideabrowser x2, IdeaBuddy, FormDesigner, Linkila, BookGraphix). Viewed representative samples. Extracted 8 NEW reusable patterns -> appended to CloviSense KB (/root/clovitek-engine/var/ui_ux_bug_kb.json), new 'ui-pattern' bucket. KB 68->76 entries. Backed up first (ui_ux_bug_kb.json.bak_ct052_*). Rebuilt RAG index (real CloviAble bge-small embedder). retrieve() now ranks founder entries #1 for dashboard(0.76)/ai-builder(0.83)/paywall(0.76). FINDING: advise() top-14 checklist is saturated by 35 block-release a11y rules so improve-priority ui-patterns only show at higher k -- ranker tuning opportunity, data path verified.
raguiknowledgeclovisense2026-06-13
CT-054 claude high
Enrich how-it-works + investors pages with the cinematic 8-scene scroll storyboard (Spark journey birth->evolution + Scene-7 flywheel money-shot)
  • [Session-A] Journey imagery generated for Our Story (about.html): 7 atmospheric FAL/flux place-plates behind each chapter (orphanage courtyard, Chernivtsi university, ocean arrival, CloviFi sound, books, NIR wheat field, CloviTek network) — dark-scrim for readability, no faces/text, on-brand. Reusable for the wayback storyboard: /www/wwwroot/clovitek.com/about-assets/journey/ch1-7.jpg
  • [Session-A] DATED ORIGIN for wayback/journey: first Manus.ai email 2025-06-25 = start of SpectroScience NIR course w/ AI. Beats: make learning engaging for students -> reused old code -> AI image trials ignored instructions + Manus projects failed (NIR slides/PPTX-video/AudiobookSmith) -> 'build my own' -> aha (capabilities=products) -> CloviTek. Now surgically edits any image (CloviImage). about.html journey ch6 updated + book buy-tabs (Amazon/Goodreads/Reviews/site) added. Full beats in CLOVITEK_FOUNDER_STORY.md.
  • [Session-A] For wayback visual accuracy: replace placeholder/AI imagery with REAL CloviFi press photos (sources in CT-084 + CLOVITEK_FOUNDER_STORY.md). New timeline node needed: 2005-2009 first product (Nokia app, VUSSC final delivery) — user providing screenshot/demo. clovitek.com 2021 Wayback snapshot to source once API un-throttled.
  • [Session-A] wayback.html needs better images (user). I STAGED 8 more HIGH-quality curated assets into /story-assets/history/: clovifi_device_mounted_on_tv_render.png, clovifi_device_on_tv_mall_render.jpg, clovifi_device_render_angle_02.png, clovitek_app_on_sony_phone_photo.png, founder_headshot_suit.png, assistive_listening_tech_comparison_table.jpg, audioeverywhere_system_architecture_diagram.png, clovitek_app_icon_logo.png. SWAP suggestions: replace the weak 'competitor_traffic_analysis_2022' UI screenshot + small/low-res shots with the device renders/app-on-sony-phone (per MANIFEST quality flags). 2005-2009 first-product section still needs the Nokia/VUSSC image (user providing). You own wayback.html — say the word if you want me to take the image pass.
marketingvisualstory2026-06-13
CT-062 claude high
CloviWayback — our own Wayback Machine: gather full delivery history (chronological + state-over-time snapshots) from all sources; timeline view; feed the story/investor pages as velocity proof
  • DONE: clovi_wayback.py gatherer (idempotent, atomic, read-only) → 556 delivery entries 2026-03-30..2026-06-13 (92 exact tracker/git/CloviPulse, 464 approx filesystem-ctime, honestly labeled). Snapshots show velocity: 6 products Jun7→50 Jun13, intel corpus 0→224. wayback.html dark/Lucide scroll timeline w/ live state-counters + velocity sparkline + prefers-reduced-motion fallback served via nginx whitelist (additive 3 location= entries, vhost backed up, nginx -t OK, HUP'd real master 1345990). Origin+edge 200, CF purged. Story-feed contract embedded for CT-054. Cron staged at /root/scripts/clovi_wayback.cron.
waybackhistorystoryinvestorclovipulse2026-06-13
CT-066 claude high
Product Intelligence Layer build
From session coordination board (owner col: —; status col: open (architecture DONE: PRODUCT_INTELLIGENCE_LAYER.md))
cross-session-board2026-06-13
CT-067 claude high
AppSumo launch prep (per-product)
From session coordination board (owner col: —; status col: dashboard + 12 format pages DONE; per-product polish open)
cross-session-board2026-06-13
CT-075 claude high
CloviTek Origins (2015-2022): CloviFi WiFi audio transmitter + SaaS/ad platform — full history captured (idea->SRS->dev->device->website 2019->marketing 2017->incorporated/taxed company)
  • Archive: docs-planning/CLOVITEK_HISTORY_2015_2022.md. From founder Drive. The evolution: CloviFi platform DNA -> CloviTek AI studio 2026.
historyclovififounderinvestor2026-06-13
CT-076 claude high
Scrape public CloviFi/CloviTek investor/crowdfunding timeline pages + ingest full company history into RAG/KB + CloviWayback + founder-journey investor narrative
  • Public pages scraped (CB Insights, PRNewswire, audioXpress, Residential Systems, PitchWall, BackerClub, Diffco case, wifihearing). Drive MCP worked: read business deck + 2022 marketing strategy. Built CPIS clovitek-origins + history RAG corpus, founder-journey narrative, CloviWayback supplement (15 timeline entries). Milestones logged. Honest caveats recorded.
historyscraperaginvestor2026-06-13
CT-077 session-a high
CloviFi origin history (2015-2022) scraped + ingested into ecosystem RAG/KB (CPIS clovitek-origins)
  • CPIS at /root/projects/clovitek-origins; corpus 06_knowledge_base/clovifi_history_corpus.md; provenance-tagged scraped/drive/reconstructed
historyragclovifi2026-06-13
CT-082 claude high
Founder American Dream arc (Ukraine->US): 2005 first idea, 2009 first product (mobile .NET survey platform, Utah Valley Univ capstone), 2017 Vernadsky Challenge, 2018 KyivHub
  • Pre-Qualtrics survey product in 2009. Archive CLOVITEK_HISTORY_2015_2022.md. Business-plan folder 1kpdLUMO.
historyfounderinvestoramerican-dream2026-06-13
CT-083 claude high
CloviWayback: organize ALL historical findings into one 2005->2026 timeline (merge supplements + CES 2018/2019, Commercial Integrator BEST Award, Kickstarter, Vernadsky, CB Insights) + ingest founder's BOOKS as source/credibility
  • DONE (CT-083): Merged ALL history into ONE 2005->2026 CloviWayback timeline. Extended clovi_wayback.py with from_supplements() ingesting 4 supplements (history_2005_2014 [NEW: arrival/2009 UVU capstone/2016 MBA], history_2015_2022, milestones_extra [NEW: 2017-03 LLC plan, KyivHub 11/26+12/02 2018, 2019-04 Inc plan, market launch], books [NEW]). 25 history milestones incl. CES 2018/2019, Commercial Integrator BEST Award, Kickstarter (~$9.6K/38%), Vernadsky, KyivHub. Books: found+verified founder's memoir 'VITALY: The Misadventures of a Ukrainian Orphan' (2021, w/ Linda Forrest; Amazon B09V2NM74M/B09VCTKML4; Readers' Favorite reviewed) — added as publication milestone + 'published author' credibility entry + Section 7 in CPIS history corpus with provenance-tagged passages. Timeline now 595 entries, range 2005..2026-06-13 (119 exact / 476 approx), all source-tagged (scraped/drive/book/git/fs/tracker). Snapshots+story_feed fixed for bare-year dates. wayback.html re-rendered (2005->2026 header + source legend), refresh cron intact, JSON synced to webroot, CF purged, live edge verified.
waybackhistorybooksinvestor2026-06-13
CT-084 claude high
Story visual-asset library: gather high-quality CloviFi/CloviTek product images (web press: CES/audioXpress/Residential Systems/Diffco/Kickstarter + box assets) for the story/investor pages
  • Founder OK to CREATE visuals too (not just gather) — story should be visually rich, not numbers/text. Mix: real CloviFi product photos (web press) + CREATED elements (SVG era-icons, illustrated 2005->2026 timeline, product-mockup illustrations, decorative treatments, the brain-wave viz) + optionally generate a few key visuals via CloviImage (dogfood our own platform; cost-aware via ai_guard). Composed into the story pages in the investor-magnetism pass.
  • [Session-A research handoff] REAL CloviFi visual sources for the story/investor pages: live wifiaudiostream.com + wifihearing.com (+ signup.wifiaudiostream.com) now placeholders (domains transferred); REAL device/app photos in press: audioXpress InfoComm2018, PRNewswire BEST-Award, GeekNewsCentral CES2019, Crunchbase, APKPure app (com.clovitek.clovitekaudio). CES 2018 HONOREE confirmed. Book real: VITALY (Amazon B09V2NM74M/B09VCTKML4, Goodreads 22286995). Origin date: first Manus email 2025-06-25. GAP: 2005-09 Nokia/VUSSC first product (user providing). Wayback API rate-limited—retry. Full list in CLOVITEK_FOUNDER_STORY.md.
  • [Session-A] CROSS-CHECK: consuming your discovery-agent's real assets — swapped about.html journey CloviFi chapter to REAL clovifi_on_tv_mall.jpg (from /press/assets/). Available reals I can also use: clovifi_device_hero/angle.png, clovifi_how_it_works.png, clovitek_app_on_phone.png, founder_headshot_suit.png, story-assets/products/vitaly.webp (book). Great work — much better than AI plates. Note any you want me to feature specifically on Our Story.
  • [Session-A] Our Story updated with discovered real assets: CloviFi on-TV plate (ch4) + inline real device render (CES2018 caption); the_factory.png on CloviTek chapter (ch7); NEW 'Then & Now' visual-capability section (THEN=2017-18 media kit [device render, how-it-works, 2017 financial chart, AudioEverywhere mockup] linked to /press/; NOW=AI-engine visuals linked to /investors.html) — investor framing 'weeks+budget then vs minutes now'. Founder photo kept as-is per user. NEED (handoff): SHARK TANK materials/images not found in Drive/Gmail/history-assets — if Session-B's discovery agent finds them, add to /press/ media kit + I'll surface on Our Story. clovitek_site_2022.png + great_visuals_deck also available.
visualassetsstoryinvestor2026-06-13
CT-085 claude high
Extract ALL founder deck visuals via gdown+unzip (the PROVEN solution to the PPTX 'capability gap') from the key CloviTek/CloviFi Drive presentations -> curate real product imagery for the story
visualassetsgdownsolution2026-06-13
CT-086 claude high
CloviForge — capability/solutions brain: queryable KB+RAG of 'task I could not do -> solution/tool', so agents route around capability gaps instead of giving up. 'If you cant do it, build it' as infrastructure.
clovforgecapabilitysolutionsethosbuildingblock2026-06-13
CT-098 claude high
CloviDOS gate #3: Admin Forge MVP -> CloviLeads admin redesign PREVIEW (mechanical compose of catalog+getContext; for user approval, live app untouched)
clovidosadminforgeclovileads2026-06-13
CT-099 claude high
Investor Starter Kit + Investor Portal — NEW PRODUCT: gated portal + lead capture + data room + in-portal NDA/EOI review & eSign (CloviLegal/Forms/PDF) + CloviDOS-built admin (Admin Forge pilot); productized for other founders. Synthesis: INVESTOR_STARTER_KIT_SYNTHESIS_2026-06-13.md
productinvestor-portalstarter-kitclovidosclovilegal2026-06-13
CT-102 claude high
Our Story page — full rebuild (animated journey + imagery + bookshelf + crawlable site header/footer)
DELIVERED /www/wwwroot/clovitek.com/about.html: animated 7-chapter scroll journey w/ FAL place-imagery (about-assets/journey/ch1-7.jpg), front book cover, all-caps gradient motion wordmark + CT glow, interactive bookshelf (open->synopsis+TOC), 'How it works' big-arrow callout, 'What's coming' 4 FAL visuals (about-assets/soon/), FULL site header+footer (crawlable, all sections). Fixed: yellow-overlay (masked-overlay bug), decoration-behind-content, badge contrast, book-cover (canonical from audiobooksmith). Cost: ~12 FAL flux images ~$0.40 + session AI.
session-adeliveryfrontendseo2026-06-13
CT-103 claude high
UI/UX + Bug RAG + external design-standards + proactive UI-QC advisor
DELIVERED /root/platform-intelligence/rag/ (ui_ux_bug_rag.json 98 rules/9 buckets, INDICATOR_COLOR_SPEC.md, PROACTIVE_SCANNER_PLAYBOOK.md) + /root/scripts/clovitek_ui_qc_agent.py (cron daily 08:13) + autofix_kb 13 entries. Built via 3 workflows (mine+external-scrape). Cost: ~3 workflows ~640k subagent tokens.
session-adeliveryragquality2026-06-13
CT-104 claude high
CloviFinance — plugin-composed financial platform design (Clovi* plugins, provenance)
DELIVERED /root/docs-planning/CLOVIFINANCE_PLATFORM_DESIGN.md (53KB): CloviCost/Price/Channel/Unit/Runway/Project/Raise/Proof over CloviCore ledger + CloviProof provenance spine; internal + sellable. 1 workflow (5 agents). Memory project_clovifinance.md.
session-adeliveryfinancialsdesign2026-06-13
CT-105 claude high
Investor financial workbook (8-tab xlsx+pdf) — true margins, cost curve, per-product P&L, pricing model
DELIVERED /root/CLOVITEK_SEO/CloviTek_Investor_Financial_Model.xlsx(+pdf): Summary, Bootstrapping, Cost Curve, Revenue, P&L, Unit Econ+Valuation, True Margins(real 84.6%), Per-Product Margins(55-90% blended 79%), Pricing Model. + charts (how_did_i_do_that.png, bootstrap_breakdown.png, per_product_margins.png). Feeds CT-059.
session-adeliveryfinancialsinvestor2026-06-13
CT-106 claude high
Pricing strategy + unified architecture + valuation research
DELIVERED /root/CLOVITEK_SEO/pricing_financials.json + SEO_AUDIT_AND_PLAN.md: hybrid disclosure, 4 tiers + add-ons + bundles + LTD + dynamic, 3-scenario 5yr model, DCF+comps valuation $12-15M PV. 1 workflow.
session-adeliverypricingresearch2026-06-13
CT-110 claude high
Investor portal: ALL investor functions + realistic DEMO-seeded dashboard (labeled sample data) so it looks alive 'as if real investors looking' - follow-up pass after portal assembly lands
investor-portalfunctionsseed2026-06-13
CT-111 claude high
Onboarding 'Get Started' element set built with CloviDOS (welcome/steps/checklist/progress) - proves we make onboarding UX; add to CloviDOS catalog
clovidosonboardinggetstarted2026-06-13
CT-112 claude high
CloviTek Plugin Library - growing registry/catalog of every plugin/element we build (onboarding, admin components, portal blocks...) as reusable building blocks
plugin-libraryclovidosregistry2026-06-13
CT-122 vitaly high
URGENT security: Bank Login Infos.docx in shared Drive folder 1WsX - founder must remove+rotate creds
securityneeds-you2026-06-13
CT-127 claude high
BUILD-EFFORT story element: 'what it took to build ONE product' (CloviFi 2015-22) - teams (Diffco iOS + Chetu backend + firmware + founder + consultants) + est hours + cost vs NOW (founder+agents); then-vs-now visual for pages
storybuild-effortteams-hoursthen-vs-now2026-06-13
CT-130 claude high
FIX build-effort bars on investors.html: they render static at final width (transition:width set but nothing changes width on reveal) -> add IntersectionObserver 0->target fill, reduced-motion safe. Apply AFTER tabs-enhancement agent finishes investors.html (avoid concurrent edit)
bugfixinvestorsanimationbars2026-06-13
CT-132 claude high
Investors page: green blinking LED live-indicators (real status from live-status.json) + 'see all live services' modal/expand
investorslive-ledmodal2026-06-13
CT-188 claude high
CloviCRM -> Postgres DONE: native contact spine (contacts.kind=investor/client/lead/partner = one store/two views), companies/deals/pipeline-stages/append-only-activities, org_id multi-tenant-READY (isolation deferred), persists across restart, license-clean. Foundation for Founders CRM (Raise) + Startups HQ (Operate)
clovicrmpostgrescrmstartups-hqfoundation2026-06-13
CT-205 claude high
CloviDOS CRM REBUILD (Phase 2 GREEN-LIT): execute /root/discovery/clovicrm-rebuild/REBUILD_BRIEF.md - sellable landing (Raise.Operate.One contact store) + 7 app screens via getContext+components on Postgres backend; strip cruft (a11y widget dashboard.html:643, cookie banner, 25 dead links, MOCK data)
  • CloviDOS CRM rebuild live: sellable Raise.Operate landing + 7 screens + cruft stripped + purged
clovicrmrebuildclovidosgreenlit2026-06-13
CT-211 claude high
SLIDER consolidated defect list (founder QA, 5 screenshots) for ONE harness-verified fix pass: (1) spotlight slides = product marketing copy bleeds as faint OVERLAPPING bg behind headline -> cluttered text formatting [CloviForms/CloviPDF]; (2) headline overflow + per-word split mangles spacing/drops words ('Your ___'); (3) 'One engine' slide: 12 fleet tiles EMPTY + big bg screen EMPTY (no app shot); (4) 'Newest' 4 thumbnails too small/cramped/UNREADABLE; (5) SLOW initial load (perf); (6) WINNING direction = device mockups w/ app clearly visible -> backbone, fewer products shown BIG. Eval harness must score all 6; bring founder screenshots+scorecard, not spot-checks
  • slider finishing pass: tiles filled w/ product shots, then-vs-now count-up+bigger fonts, harness calibrated; verified
clovisliderdefectsconsolidatedharness2026-06-13
CT-227 claude high
GAP: CloviLegal landing + AppSumo pages NOT updated for the upgraded product. Still lead with Clause DNA/eSign/contracts (old). MISSING: Startup Legal Advisor, entity guidance (LLC->C-corp), IP/trademark, auto-drafted founding docs (IP assignment/CIIAA/SAFE/board consent), counsel-review gate. UPDATE clovilegal.html + appsumo-clovilegal.html to lead with 'AI legal OS for founders: from idea to incorporated' + the advisor; refresh comparison vs Clawdia/DocPro/LegalZoom.
  • APPLIED: clovilegal.html (new hero 'AI Legal OS that takes a founder from idea to incorporated/fundable/signed' + 7 capability cards incl Startup Advisor/founding-docs/IP-trademark/counsel-gate + advisor link + honesty note) + appsumo-clovilegal.html (new H1 + rewritten TL;DR) + investors.html CloviLegal blurb. All live+purged. Homepage = NON-ISSUE: live homepage is the current Next app ('White-Label Platform Engine'); the stale 'audio/video/CES2018' index.html was a dead 301-redirected file -> disabled as _legacy_index.html.disabled.
clovilegallandingappsumopositioninggap2026-06-13
CT-238 claude high
Homepage: OLD text-header + 2 CTAs still showing alongside the new slider (duplicate hero) - reconcile: slider IS the hero, remove/merge the old separate text+CTAs, keep SSR SEO h1/meta
  • FIXED+LIVE: removed static hero headline+2 CTAs; CloviSlider is single hero + sr-only SSR h1 for SEO; nav-aware 100svh-64px height. Verified public h1=1, no 'Fully Operational'. CDN purged.
homepagesliderheroduplicate2026-06-13
CT-247 claude high
REAL spend ledger from Drive crawler — crawl ALL financial source docs (filed 1120s, invoices, checks, bank/CC statements, receipts, retainers) -> sourced line-item spend ledger w/ provenance, NOT memory estimates. Founder may UNDERestimate. Confirmed so far: Canyon PR $9,139.99, Diffco $64,931, Chetu ~$47K, patent ~$40K, 1120 basis $162,177. Output /root/discovery/spend-ledger/SPEND_LEDGER.md -> feeds the-numbers.html + then-vs-now (CT-244)
  • DONE: /root/discovery/spend-ledger/{SPEND_LEDGER.md,spend_ledger.json} 40 cited records. True de-dup outlay ~$171,533; naive $218,454.57; realistic all-in >$175K plausibly $190-210K. Founder underestimates (Chetu $17,326.71, Freeman|Lovell $8,400, Diffco ~30 invoices missing). Saved to memory.
financialsspend-ledgercrawlerthen-vs-nowprovenance2026-06-13
CT-248 claude high
Homepage: full-page YELLOWISH tint overlay (correct on first paint -> CloviAble clovi-able.min.js afterInteractive applies persisted color-filter/theme profile) that (a) tints analytics numbers off-green and (b) layers above + hides the 3 floating icons. Live-only (in saved localStorage ca-theme/filter), not in static HTML so screenshots look green. FIX: default cloviable to no-filter, audit theme bridge in layout.tsx, clear stale profile. Founder reported live 2026-06-13
  • FIXED+LIVE: removed cloviable external script + theme-bridge (CORS-fallback was applying page-wide yellow filter + ca-theme=light mirror); added untint guard (strips data-theme/data-ca-theme on load + filter:none). Verified public cloviable=0, untint=4. User must hard-refresh (stale localStorage/HTML). Re-enable a11y widget after cloviable CDN serves CORS + no-filter default.
homepagecloviableoverlayfloating-iconsbug2026-06-13
CT-250 claude high
CloviSlider: the multi-ROW 'deliveries' slide (product/category grid) overflows the viewport — rows don't fit on screen (clipped/scroll). FIX: constrain slide to 100vh/frame height, cap rows or auto-fit grid (responsive columns + max-rows), scale tiles to fit, no page overflow. Part of hero/slider reconcile cluster (CT-238). Founder reported 2026-06-13
  • Root cause of CloviLegal/all device shots not rendering on HOMEPAGE = config shotBase/assetBase were RELATIVE ('products/shots/') -> resolved to clovitek.com/products/shots/ (404) off-homepage; fine only on showcase.html in that dir. FIXED: made absolute (/story-assets/...) + added mobileBase; engine mobile fallback already absolute. Validated JSON + purged config.json. Live after hard-refresh.
clovislideroverflowviewportresponsivebug2026-06-13
CT-253 claude high
CloviSlider PLATFORM research fleet — gather intel to design a slideshow platform w/ prebuilt templates + effects. 5 agents -> /root/discovery/slider-platform/: (1) competitor teardown, (2) template+effects taxonomy, (3) OSS engines+licensing build-vs-buy, (4) AppSumo/PH market+pricing+gap, (5) no-code builder UX patterns. Synthesize into PLATFORM_DESIGN_BRIEF.md next session.
  • Agent 04 market/pricing DONE: incumbents commoditized (SliderRev 375k Envato sales; SmartSlider 900k installs; Elfsight views-metered $6-24/app; CommonNinja unlimited-views wedge). GAP nobody owns = CWV-safe + auto-fit + AI-prompt-generated + white-label slider. Rec pricing: Free(unlimited views)/Pro $12/Agency $39 vs $336 enterprise gate; AppSumo LTD $59/119/199 x3 stack. Positioning: 'the slider that makes Core Web Vitals BETTER, generated from a prompt, auto-fits every screen, white-label'. -> 04_market_pricing_gap.md
  • Agents 01+03 DONE. 01: fixed-canvas clipping is industry-wide documented failure (validates auto-fit wedge); power-vs-perf tradeoff unbroken; AI/self-evolving + white-label + AppSumo = 3 open lanes. 03 OSS verdict GREEN/BUILD-on-MIT: Swiper11(MIT)+Motion+WAAPI core; in-house fit=scale()+ResizeObserver+svh+container-queries (Canva/Pitch method); moveable for editor; ~25KB viewer budget. TRAPS: Flickity GPL, Theatre.js studio AGPL, GSAP free-but-non-OSI(lazy-load only). Reports 01/03 in /root/discovery/slider-platform/.
  • Agent 05 builder-UX DONE: our admin already mounts the REAL engine in preview (true WYSIWYG) — add layer tree + canvas manipulation + brand theming + template gallery. IA = SmartSlider3 5-region + Canva click-to-edit/Brand-Kit/apply-to-all. AVOID SliderRev maximalism + un-undoable actions (every action undoable). FLAGSHIP AI = 'Generate-a-slider-from-URL' (crawl site->extract brand kit+content->themed populated deck; reuses LLM cascade+brand tools+CloviImage) — nobody in category does it. -> 05_builder_ux_patterns.md. Only WPBakery(06) left, then synthesize PLATFORM_DESIGN_BRIEF.md
  • ALL 8 reports done + SYNTHESIZED -> /root/discovery/slider-platform/PLATFORM_DESIGN_BRIEF.md. Thesis: only slider that's powerful+fast+auto-fit+AI-generated+white-label+self-improving. Stack=BUILD-on-MIT (Swiper11+Motion+WAAPI, in-house fit, moveable). Engine=CloviCanvas declarative registry (WPBakery JSON-tree + Elementor token-CSS/global-kit/templates, single isomorphic renderer, param_group first). 28 templates/12-ship-first. AI flagship=Generate-from-URL. Pricing Free/Pro$12/Agency$39 + AppSumo LTD $59/119/199. Build seq C5->C4->C1->C2->C3. Founders packaging mapped. See CT-256 (CloviCanvas), CT-238/248/249/251/239 next steps.
  • Report 09 cinematic effects DONE -> 09_cinematic_effects.md. Ship-first 10 (sheen/vignette/grain/KenBurns/tilt/parallax/aurora/god-rays/bokeh/shimmer-text), CWV-safe (transform+opacity only; WebGL opt-in 1 slide max w/ CSS fallback). License trap: Shadertoy=CC-BY-NC + Lottie/FlexClip JSON own-license -> re-create procedurally. EffectLayer interface plugs into LayerTimeline in/loop/hover. Now 9 reports total feeding PLATFORM_DESIGN_BRIEF.md (add effects pack to library spec).
clovisliderplatformresearchtemplateseffectsfleet2026-06-13
CT-254 claude high
Inspect WPBakery (js_composer) + Ultimate_VC_Addons + Salient/Mega-Addons/Shortcodes-Ultimate on vitalybook.com + vitalwebmaster.com -> extract builder architecture ideas (shortcode/element schema, param-map editor, element registry, frontend inline editor, templates/blocks, responsive controls, design options) to enhance CloviSlider builder + CloviCode/website builder. Output /root/discovery/slider-platform/06_wpbakery_builder_teardown.md
  • DONE -> 06_wpbakery_builder_teardown.md. Core: vc_map = single declarative spec = identity+storage+auto-panel. Modernize to JSON-Schema + JSON node tree + React renderer. Build param_group (repeater) FIRST (slider=repeater of slides). dependency->JSON-Schema if/then. Per-breakpoint structured style objects compiled at publish. Top-10 widgets shortlist. Clean-room: namespace clovi/, no vc_*/ultimate_* names or bundled fonts.
wpbakerybuilderteardownclovicodeclovislider2026-06-13
CT-255 claude high
Inspect Elementor + Elementor Pro + Essential/Premium/The-Plus Addons + Astra Pro Sites + JetPopup + Essential Blocks on searchengineseer.com -> extract widget registry (Widget_Base controls API), template/demo-import library architecture, responsive/global-styles (kits), popup builder, theme-builder (header/footer) patterns to enhance CloviCode/website builder + CloviSlider. Output /root/discovery/slider-platform/07_elementor_builder_teardown.md (ARCHITECTURE ideas only — GPL/commercial, write our own)
  • DONE -> 07_elementor_builder_teardown.md. Take from Elementor (superior to WPBakery): {{WRAPPER}}/{{VALUE}}/{{SIZE}}{{UNIT}} token CSS generator (schema->scoped CSS, #1 pattern); Global Kit (system colors/typography->CSS vars); breakpoints-as-data(7); conditions/showIf; group controls+hover states; template.json x3 granularities + match_site token remap + batched async starter-site import (Astra Pro Sites model); popup=triggers/timing/conditions; theme-builder=locations+conditions. IMPROVE on Elementor: single ISOMORPHIC renderer (not dup PHP render + JS content_template). Net: WPBakery JSON-tree serializability + Elementor CSS-gen/responsive/conditions/global-design. Reconcile 06+07 in synthesis.
elementorbuilderteardownclovicodeclovislider2026-06-13
CT-257 claude high
Tech-capabilities investor page (/engineering.html or /tech.html) — 'dev stack flex' for technically-savvy investors: REAL sourced metrics + visuals. Pull from: agent_build_ledger (~27 agents, ~10min/$0.53 each), app_registry (247 apps/67 PM2), live-status.json (products live), ui_ux_bug_kb (16 RAG rules) + other RAGs, services_health grade, cloc LOC counts across codebases, tech stack inventory (langs/frameworks/DBs/MCP/AI models), architecture diagram, agent fleet map, CWV dogfood before/after. Animated counters + charts (reuse investor-charts + visual-rich UI standard). NO vanity/made-up numbers — provenance-tagged like the-numbers.html. Link from investors.html. Draft first, verify numbers, then deploy+purge.
  • Research agent dispatched -> /root/discovery/tech-showcase-research/VISUAL_PATTERNS.md: mines OSS (github-readme-stats, shields/skill-icons, heatmaps) + respected eng pages (Vercel/Linear/Resend/Supabase/Cloudflare/Stripe 'by the numbers') + status dashboards + architecture/agent-fleet diagram styles + viz libs (CloviCharts/D3/ECharts/Mermaid/react-flow/three-globe). Produces metric->visual->library mapping + section-by-section layout for engineering.html, honest-numbers-first (avoid vanity/fake-realtime/badge-soup). Feeds the builder agent's page.
  • Visual-patterns research DONE -> /root/discovery/tech-showcase-research/VISUAL_PATTERNS.md. KEY: for tech investors failure mode = cheesy/inflated, NOT plain; honest-numbers is the DIFFERENTIATOR (show mocked modules + bad uptime days honestly). Top devices: live-demo>claim (Vercel real-latency style), status-grid+90d-uptime bars (services-monitoring-agent 47svc = strongest anchor), 'afternoon-of-work' Gantt from real commit timestamps (8-agent slider fleet). Libs: CloviCharts default + Mermaid(arch/sequence/gantt) + react-flow(fleet graph) + ECharts(status). CUT 3D globe (vanity). 10-section layout spec'd. Reconcile into engineering.html when builder agent lands.
  • REUSE OUR OWN code + docs (don't duplicate): mine internal sources BEFORE/while building — investor-charts/ (existing chart assets+data), existing story pages the-numbers.html/how-it-works.html/investors.html/wayback.html (reuse styling+real numbers+provenance pattern), the FULL /root/discovery/ research tree (slider-platform, homepage-qc, spend-ledger, canyon-pr, tech-showcase-research), /root/docs-planning/ + /root/platform-docs/ + per-platform /docs/ system, services-monitoring-agent data, agent_build_ledger, MEMORY topic files. Collector should read these real artifacts; page should match existing story-page look. Cross-link engineering.html with the-numbers/how-it-works/investors so the tech story completes the financial+journey story.
  • LIVE: clovitek.com/engineering.html (200, nginx static block added + HUP'd master 1345990 + CDN purged). Real numbers: 27 agents avg 9.6min/$0.53, 18/19 live, 268,593 LOC, Grade A, 0 faked (collector gen_tech_metrics.py, 0 flags). Linked from investors.html+hub. TODOs in page: swap inline SVG->CloviCharts embeds; link homepage-qc CWV report URL. Next: CloviMetrics widget syndication (CT-258).
investorengineeringtech-showcasemetricsreal-numberspage2026-06-13
CT-002 claude medium
CloviLegal learning loop
  • DONE: 294-chunk legal RAG (bge, provenance-cited), warm sidecar :8993, learning loop mining reviews, both agents wired latency-safe; early data (2 contracts), meaningful at >=8 auto
clovilegallearning-loop2026-06-13
CT-003 claude medium
CloviIdea learning loop
  • DONE: idea/market RAG + learning loop, latency-safe (0.38ms, no model on web path), feeds CloviVenture export; signal early/needs-more-data
cloviidealearning-loop2026-06-13
CT-015 claude medium
CloviDOS MVP core (getContext API live)
2026-06-13
CT-016 claude medium
CloviAble->CloviSense intelligence feed
2026-06-13
CT-017 claude medium
CloviPDF My-Files
2026-06-13
CT-018 claude medium
CloviLegal 160->142 honesty fix
2026-06-13
CT-019 claude medium
CloviDecks credit cap
2026-06-13
CT-020 claude medium
Backend reality audit
2026-06-13
CT-021 claude medium
Widget host-safe rework + one-clean-button + More-options
2026-06-13
CT-025 claude medium
Sites: CloviTrade (emerald), CloviCRM (indigo), clovidecks→main-domain forward + 24 template previews, cloviflip platfor
agent-logsession-2026-06-132026-06-13
CT-026 claude medium
Security/auth: CloviPDF /output IDOR closed; central clovitek-sso minter (:8991) + 9-app wiring; CloviPDF login hang; co
agent-logsession-2026-06-132026-06-13
CT-027 claude medium
33 landing pages enriched to house standard.
agent-logsession-2026-06-132026-06-13
CT-028 claude medium
Monitoring: 34 product subdomains + SSO + platform added (was 11). Grade A.
agent-logsession-2026-06-132026-06-13
CT-029 claude medium
Test accounts admin@/user@clovitek.com seeded into every app.
agent-logsession-2026-06-132026-06-13
CT-030 claude medium
Restart-loop investigation: none active (stale counters reset). 2 DB-grant follow-ups logged.
agent-logsession-2026-06-132026-06-13
CT-031 claude medium
AppSumo: research + dashboard + 12 format pages + founder profile.
  • [Session-A] Press/Media KIT page built: /press/kit/ — boilerplate+founder bio+fact sheet+awards(CES2018 Honoree/CI BEST)+15-asset gallery w/ honesty captions (Audio Everywhere predecessor, 2017-projection excluded)+downloads (zip+boilerplate.txt). Guardrail-safe (no $1M/revenue, Honoree not Best, 10+ yrs). Complements Session-B /press/ portal. Spec: /root/CLOVITEK_SEO/press_kit_spec.json. TODO before public: confirm incorporation year, HQ city, press@ email.
agent-logsession-2026-06-132026-06-13
CT-032 claude medium
Product Intelligence Layer architecture doc (A-R).
agent-logsession-2026-06-132026-06-13
CT-033 claude medium
2 review pages (build-showcase, recommendations) + AppSumo review dashboard.
agent-logsession-2026-06-132026-06-13
CT-057 claude medium
CloviDOS: turn the 8 founder-extracted UI patterns into real components/page-templates (app-shell, data-table+status-pill, AI-builder split-pane, prompt-bar generator, sidebar+empty-state, locked-preview paywall)
clovidoscomponents2026-06-13
CT-069 session-a medium
Finish auth (clovicharts/cloviscan own cookie, Google OAuth, shared entitlement)
From session coordination board (owner col: **SESSION-A**; status col: IN PROGRESS — app.<domain> split done for clovicharts.com + cloviscan.com (/login→app.*) 2026-06-13)
cross-session-board2026-06-13
CT-078 session-a medium
CloviFi 2017 Kickstarter campaign (~$9,593, ~38% funded) + Vernadsky Challenge recognition
  • 2017-08-29 launch [scraped backerclub/residentialsystems]
historymilestonefundraise2026-06-13
CT-079 session-a medium
CloviFi awards: CES 2018 Innovations Honoree + Commercial Integrator 2018 BEST Award (InfoComm)
  • 2018-01 CES; 2018-06-07 CI BEST [scraped prnewswire/cbinsights]
historymilestoneaward2026-06-13
CT-080 session-a medium
CloviTek Inc incorporated/operating: clovitek.com live 2019, 2019+2020 tax returns, CES 2019
  • SLC Utah; [drive tax returns + scraped]
historymilestoneincorporation2026-06-13
CT-081 session-a medium
Founder-journey investor narrative 2015-2026 + CloviWayback 2015-2022 supplement
  • narrative at docs-planning/IDEA_TO_PRODUCT_BRAINSTORM/05_FOUNDER_JOURNEY_2015_2026.md; supplement /root/.clovitek/clovi_wayback_history_2015_2022.json
historyinvestornarrative2026-06-13
CT-088 claude medium
AppSumo buyer-side expense analysis (~$32.6K/179 LTDs, Plus ROI 12.5x) -> feeds Wayback financial timeline + investor 'bootstrapped owned-stack' moat; reconcile when 179-line CSV lands from other session
financialappsumowaybackinvestor2026-06-13
CT-101 claude medium
Found + inventoried the original 2015-2020 CloviFi investor data room (50+ files Drive folder) incl. Maglioli Consulting contract = DOCUMENTED proof of paid consultant for the then-vs-now story; upgraded proof provenance to DOCUMENTED. Inventory: CLOVIFI_DATAROOM_2015_2020_INVENTORY.md
investorhistorydataroomproofthen-vs-now2026-06-13
CT-108 claude medium
CloviDOS Admin Forge PROVEN on real panel (investor-portal admin composed from live 26-component catalog) -> CT-008 CloviLeads redesign now technically unblocked; awaiting founder go
clovidosadminforgemilestone2026-06-13
CT-109 claude medium
Preview Hub (one page linking ALL session pages+backends, honest status) at clovitek.com/story-assets/hub.html
hubpreview2026-06-13
CT-114 claude medium
Investor pages: real logo + recent headshot swap; 'Explore the fleet' product showcase (19 live landing pages) on how-it-works; diagnosed yellow-tint = user display/Night-Light filter not page
investor-pagesfixfleetvisual2026-06-13
CT-124 claude medium
Press/Media portal LIVE at clovitek.com/press (for Xenia) - story+kit+downloads+coverage; nginx whitelisted+purged
pressmediaportalxenia2026-06-13
CT-129 claude medium
Agent Build Ledger live (avg ~10min/~$0.53 per new agent, 27 builds, $14 total) - feeds then-vs-now; CloviCost realtime spend metering = other session (consume, don't duplicate)
ledgeragent-costclovicostcoordination2026-06-13
CT-131 claude medium
live-status.json generated (18/19 products live, 48 svcs Grade A) + gen_live_status.py (re-runnable/cron-able)
live-statusinvestors2026-06-13
CT-133 claude medium
Founder accepts leaving passport/personal docs in shared Drive (their call); only Bank Login creds noted as optional rotate - flagging stopped
securitydecision2026-06-13
CT-134 claude medium
CloviLegal Startup Advisor PLUGIN — founder admin panel LIVE at clovitek.com/legal-advisor (pm2 clovilegal-advisor:8996); entity-structure report + roadmap + grounded Q&A. NEXT: CloviDOS full build (intake->roadmap->contract drafting studio on CloviLegal 8987 RAG + Clause DNA + counsel-review gate)
  • @session-b: Startup Advisor LIVE at clovitek.com/legal-advisor feeds your CT-060 Investor Portal + CT-099 data room — embed the roadmap/checklist + 'questions-for-counsel' there; report at /root/company-assets/legal/CLOVITEK_ENTITY_STRUCTURE_REPORT.md. Verdict: stay LLC now (loss pass-through vs ~$250K personal tax), convert to DE C-corp at first priced round. CloviDOS: build full intake->contract-drafting-studio on CloviLegal 8987 w/ Clause DNA + counsel-review gate.
  • DRAFT DOCS generated + LIVE in panel (Documents section, downloadable): IP/Tech Assignment, CIIAA, Board Consent (founder stock+vesting+83b), Post-Money SAFE setup sheet. Saved /root/company-assets/legal/drafts/. All stamped DRAFT-FOR-COUNSEL. SAFE intentionally a setup-sheet pointing to official YC form (correct practice). @session-b: these feed CT-121 blueprint + CT-099 data room.
legalclovilegalpluginfundraising2026-06-13
CT-137 claude medium
AppSumo landing-page sweep: 21 unique colorful product pages found (was 19); added CloviCover+CloviRedact to how-it-works fleet showcase
appsumofleetlanding-pages2026-06-13
CT-138 claude medium
Pre-revenue valuation (today $): ~$750K most-likely, $500K-$1.2M range via Berkus/Scorecard/RiskFactor/VC/Cost-to-Duplicate + zero-traction weighting. Doc: /root/CLOVITEK_SEO/CLOVITEK_PREREVENUE_VALUATION.md. KEY: wiring Stripe (CT-004/005) is the biggest valuation lever. @session-b: use for Investor Portal CT-060/deck CT-061 (honest range, NOT a hype number). Market-comps agent socket-failed; re-run for live multiples if needed.
valuationfundraisingfinancials2026-06-13
CT-139 claude medium
Investor portal interlinked to all 5 surfaces (journey/numbers/pitch+fleet/timeline/press) via nav+explore grid+footer; gated flow intact. Investors page got full 21-product fleet w/ live LEDs
interlinkinvestor-portalfleetnavigation2026-06-13
CT-142 claude medium
IP/Copyright agent LOOP built: /root/scripts/ip_copyright_agent.py (weekly cron Mon 06:30) inventories fleet -> IP_REGISTER + review queue; intelligent scoring via ip-opportunity-scan workflow. Register: /root/company-assets/ip/. First pass scored 7 crown-jewel methods (Conform engine/agent factory/learning loops/provenance/RAG advisor/CloviCost/brand) -> patent/copyright/TM roadmap. Extends CT-126 CloviPatent. NOT legal advice -> for IP counsel.
  • IP ROADMAP done -> /root/company-assets/ip/IP_PROTECTION_ROADMAP.md. VERDICT: patents are THIN across all 7 methods (weak patentability, high prior-art, Alice/101, FTO risk). Real moat = TRADE SECRET + COPYRIGHT + TRADEMARK. Cheap first moves: (1) trade-secret hygiene NOW (NDAs+IP-assignment for humans AND agents, keep engines server-side/out of git), (2) USPTO knockout search on CLOVI/CLOVITEK classes 9/42/35/36 (watch Clover/Fiserv + Clovis conflicts), (3) copyright-register each engine's source, (4) copyright-register the KB compilations. Patent spend ONLY on a narrow provisional if counsel finds a concrete non-obvious mechanism.
  • TM KNOCKOUT done -> /root/company-assets/ip/TRADEMARK_KNOCKOUT_CLOVI_CLOVITEK.md. ★MAJOR: CloviTek ALREADY owns CLOVIFI Reg.5401258 (LIVE, filed 2017, software/HW wireless) — confirm Sec.8/9 maintenance. CLOVITEK house mark = OPEN, file first in Cl.9+42 (LOW-MED). Bare CLOVI riskier; CLOVER/Fiserv (Cl.9/35/36/42, litigious) is #1 risk esp. Cl.36 (HIGH) -> keep CloviCost/CloviFinance under house mark or non-payment IDs. File ITU now; full attorney clearance before filing.
ippatentcopyrightgovernancelifecycle2026-06-13
CT-145 claude medium
Platform admin nav: added Founder HQ + Investor Portal + Legal Advisor + Press Kit links to DashboardLayout externalLinks; rebuilt+restarted clovitek-platform (online, verified in bundle). Founder HQ page at platform.clovitek.com/founder-hq/.
owner-panelnavdone2026-06-13
CT-147 claude medium
Founder Report format BUILT (reusable, CloviAble fingerprint): founder_report.py renders agent data -> formal report (cover+Report ID+methodology+gauge+sectioned findings) + exportable FOUNDER ACTION PACK (print-to-PDF + copy-share-link). Storage model: agent JSON -> /root/company-assets/<domain>/ -> versioned report w/ Report ID -> /root/company-assets/reports/ + index.json. First report = IP/Trademark, LIVE at platform.clovitek.com/founder-hq/reports/ip-trademark.html. IP card added to Founder HQ.
reportsfounder-hqipdone2026-06-13
CT-148 claude medium
Fleet links FIXED to colorful /appsumo/<slug>.html (12) + subdomain fallback (9); 12 colorful pages re-screenshotted (outcome-showing); annotations re-anchored. 9 products lack colorful pages: clovileads/cloviidea/clovibrand/clovicode/clovinarrate/clovilearn/cloviflow/clovicover/cloviredact
fleetlinksscreenshotsappsumo2026-06-13
CT-158 claude medium
Report & Action-Propagation FRAMEWORK built (v1): framework doc CLOVITEK_REPORT_AND_ACTION_FRAMEWORK.md + action_bus.py (single append-only bus) + founder_report.emit_actions. Composable BOTH ways: Report->Idea->Venture->Company AND Idea->IP-screen->Company (ip_section_for_idea embeds IP research into opportunity reports). Every action routes to CloviTrack+Founder HQ, market/product->CloviIdea, venture->CloviVenture; provenance (MEASURED/ASSUMED) carried through; status loops back. PROVEN: IP report emitted 8 actions, 8 tracked, 1 routed to CloviIdea. Productizable as CloviReport/CloviDOS module.
frameworkreportsaction-buslifecycleproduct2026-06-13
CT-159 claude medium
Founder HQ now FULLY FUNCTIONAL: Valuation + Legal/Entity reports generated (founder_report format) + live Reports & Actions index (fetches reports.json + actions.json; 16 actions on bus w/ priority/category/owner/routing). 3 formal reports live at platform.clovitek.com/founder-hq/reports/. IP card links report.
founder-hqreportsdone2026-06-13
CT-167 claude medium
CloviStart opportunity study DONE (score 58/100): AI-native Founder OS beats Foundersuite by covering idea->plan->deck->dataroom->investor CRM->eSign->updates in ONE threaded record. Legal investor DB = SEC EDGAR Form D/C/A+ spine (free, public domain) + owned leadgen enrich (NOT crawl-and-pray). Gap = no owned cap-table engine. Report LIVE: founder-hq/reports/opportunity-clovistart.html. Perfex CRM study -> Founders CRM patterns (Krayin/Atomic MIT forkable; Twenty AGPL AI-native ref). Foundersuite UI teardown saved. @session-b CT-060/CT-099.
clovistartopportunitycrmreports2026-06-13
CT-168 claude medium
Portfolio/ecosystem strategy DONE: run CloviTek as ONE founder-OS (CloviStart house-of-brands), NOT 34 flat tools. CloviLegal=flagship (score 9, spin out LATER after ~$1M ARR in-suite, NOT standalone-fundable alone). Eventual standalone: CloviSpectra(7, diff buyer), CloviAble(7). KILL/MERGE: CloviSEO->fold into Scan. Keep-in-suite: everything else (PDF/Forms/Image/Code/Flow/Leads/Decks/Cost=backend/funnel). Sequencing: Stripe first->CloviLegal AppSumo->funnel lock-in->cross-sell->spin-outs. Report: founder-hq/reports/strategy-portfolio.html
strategyportfolioreports2026-06-13
CT-169 claude medium
FIX CC\>/CR\> artifact: fleet onerror tile fallback didn't escape double-quotes (broke the attr, leaked CloviCover/CloviRedact initials as text); added &quot; escape on both pages. + enriched 'Built with capabilities it sells' section
bugfixfleetartifact2026-06-13
CT-170 claude medium
FIXED CloviLegal doc-generation paywall bug (AppSumo frustration): root cause = new signups default plan='free' which allowed only ai_reviews:2/mo AND generation shares that bucket -> users hit 402 after ~2 docs. Fix: bumped free to docs:8/ai_reviews:8 (genuine trial) + added appsumo_tier1/2/3 LTD plans + hardened planGate (unknown plan->free, unknown action->unlimited, never 500). Anthropic key verified valid (200). Restarted clovilegal (cluster). Files: clovilegal/config/index.js + middleware/planGate.js.
clovilegalbugfixappsumodone2026-06-13
CT-174 claude medium
Removed newsletter forms from landing footers (cloviforms/clovilegal/clovipdf) -> clean 3-col menus
footerlandingcleanup2026-06-13
CT-176 claude medium
Investor-data sourcing — SEARCH capability audit of owned APIs: CLODURA ✅ POST /api/v1/search/people (B2B people search by criteria) · AIMFOX ✅ search_leads + search_leads_facets (LinkedIn search by company/location/title/skills, confirmed live) · PROSP ~ (prospecting/intent, campaign-add) · DATABAR.ai ❌ API enrichment NOT functional on our tier — UI-only 'Run all rows now' (needs tier upgrade to query programmatically). So CloviStart investor DB = EDGAR spine + Clodura/Aimfox SEARCH to find names + enrich. Full data-platform landscape report saved.
clovistartleadgendatabarresearch2026-06-13
CT-177 claude medium
CloviStart HR/Team module (add-on) speced: source(Clodura/Aimfox)->offer/contractor/CIIAA/equity(CloviLegal eSign)->onboarding(CloviForms)->team_members table. Open-source HRIS=reference only, build native. Ties to cap-table/equity gap.
clovistarthrproductspec2026-06-13
CT-178 claude medium
ARCH DECISION — Founders CRM (and reusable CRM kernel) built on OWNED WorkDo Dash modular base (Lead/Hrm/Taskly/Account/Stripe modules), NOT from scratch. Harvest patterns from owned Perfex + CloviCRM + ERPGo. AI agents wrap records, never rebuild CRUD. WorkDo Hrm=the HR/team module; WorkDo Stripe module may help CT-004 billing. One kernel -> many platform skins. Spec sec.10. Per clovitek_workdo_plugins_buildbuy_plan.md. Cross-session: both studied Perfex (don't re-run).
  • SUPERSEDED re: kernel — WorkDo/Perfex CANNOT be the SaaS spine (CodeCanyon license forbids resale; perfex_saas exceeds Regular license). Correct decision (per CT-179): build NATIVE on CloviCRM+CloviTrack+Postgres; WorkDo/Perfex = reference + back-office only. The reusable-kernel goal stands but the kernel is OUR native Postgres CRM, not WorkDo.
clovistartcrm-kernelworkdoarchitecture2026-06-13
CT-186 claude medium
CloviTrack: atomic ID lock + auto-render board on every change (fixes cross-session CT- id collisions + stale clovitrack.html)
clovitrackinfradone2026-06-13
CT-189 claude medium
AMA (first-startup lessons) mined -> /root/clovistart-research/AMA_LESSONS_TO_CLOVISTART.md: story beats (orphan/Ukraine/$3/TV-under-covers), real lessons (crowdfunding/agencies 'Do not do it'/manufacturing/pricing/B2C-vs-B2B mistake/backup plans), 12-row Pain->Product map, 5-7 product principles, investor hooks. LOAD-BEARING QUOTE: 'I wish I had all that knowledge about starting/running the business, IP protections, finances earlier' = THE CloviStart thesis. Founder's scars = the product spec. Feed: investor narrative (CT-061), Our Story, founder-advisor KB, CloviStart positioning.
amaclovistartstoryinvestorpositioning2026-06-13
CT-190 claude medium
2009 origin film LIVE: clovitek.com/story-assets/video/clovitek_2009_origin.mp4 (36.5s, real screenshots: Login->XML survey->collect anywhere->3G/web-service/SQL->web portal->Wireless2009/WiFi2017/AI2026->professor 'there's a business here'). Real screens at story-assets/history/2009/. EMBED on investors page + wayback + about.
video2009investorstorydone2026-06-13
CT-191 claude medium
Investors page enriched: rich ORIGIN section — embedded 2009 origin film + poster + verbatim AMA story-beat cards (TV-under-covers/caroling/2009-miss/thesis quote) + Wireless2009->WiFi2017->AI2026 arc strip. '$3 to 17-year platform thesis'. Live + purged. Engaging emotional open before the financials.
investorsstoryvideorichdone2026-06-13
CT-192 claude medium
Enriched wayback.html + about.html with cinematic 2009 origin: embedded origin film + real 2009 screenshots (login/XML-survey/architecture/web-portal) in wayback 2005-2009 era; film + thesis pull-quote ('I wish I had that knowledge earlier') on about Our Story. Matches each page's theme. Live + purged. (investors done CT-191)
waybackaboutstoryvideorichdone2026-06-13
CT-193 claude medium
Legal answered (informational): CAN outreach as CloviTek pre-incorporation — talking/soft-circling = not securities activity; convert to DE C-corp only to CLOSE (when investor ready to wire). Keep Vital Webmaster LLC separate (don't co-mingle IP). Don't sign SAFE as LLC. ASK investors their entity preference (free intel). Doc: /root/company-assets/legal/OUTREACH_BEFORE_INCORPORATING.md. ALSO: add Strategic/Acquirer segment to CRM (acquihire path).
legalfundraisingoutreachdone2026-06-13
CT-194 claude medium
Pitch deck (12-slide pre-seed) + outreach workflow engine + one-pager + playbook BUILT: /root/company-assets/PITCH_DECK_CLOVISTART.md + clovistart-research/fundraising_arsenal.json. Find->enrich->score->outreach->present->track pipeline w/ readiness gate (warm now, cold after Stripe+entity). Render deck to Founder HQ format next.
pitchdeckarsenalfundraisingdone2026-06-13
CT-195 claude medium
BUILDING: True Company Value indicator (reusable Founders-CRM feature) — agents gather asset/IP value + 3yr revenue projection + similar-STAGE comps (web) + AI synthesis -> single value number+range+confidence+drivers+levers. v1 for CloviTek (~$750K). Will surface as live gauge in Founder HQ + CRM column per founder. wf_9cfa6873.
valuationindicatorcrmclovistartai2026-06-13
CT-196 claude medium
Dual-mode True Company Value indicator LIVE in Founder HQ: RAISE value $750K ($500K-$1.2M, levers w/ $ deltas — Stripe=+$250-600K) + SELL value (pre-revenue: low-to-mid 6 figures realistic, up to $1-3M strategic/acqui-hire; earnings/ARR multiples DON'T apply pre-revenue) + Preparing-to-Sell exit-readiness (8 items w/ value impact). Real M&A research: SDE/EBITDA/ARR multiples, strategic vs financial, marketplaces. Docs: company-assets/HOW_COMPANIES_ARE_VALUED_TO_SELL.md + value_indicator_*.json. Reusable per-founder CRM feature.
valuationindicatorsellexitcrmdone2026-06-13
CT-197 claude medium
CloviSlider v2 cinematic LIVE: fixed not-moving (loop+disableOnInteraction), autoplay+toggle, WAAPI LayerTimeline (in/loop/out + Penner easings + 15 presets), 3D device mockups w/ real app shots, per-word cinematic type, A/B+analytics+dynamic feeds intact, license-clean
clovislidercinematicdone2026-06-13
CT-200 claude medium
Visual inspection PROVEN + wayback fixes: (1) I visually inspected the 4 real 2009 images (architecture diagram = best, emulator screenshots authentic-but-raw). (2) Fixed 2018-2019 era: swapped wrong app/diagram images for honest CES 2018 Honoree + CI 2018 BEST award badges (composed; real CES logo NOT reproduced - awaiting real award graphic if user has it). (3) Added REAL book cover (vitalybook-front.jpg) + real buy links (Amazon B09V2NM74M/B09VCTKML4, Goodreads, Readers Favorite) to wayback record section, replacing placeholder. Image-eval code exists: audit_cover_images_vendor.py -> wire as reusable image-scorer (NEXT).
waybackimagesvisual-inspectionbookawardsdone2026-06-13
CT-201 claude medium
Homepage: prominent For Investors (amber) + Press/Media nav links added (desktop + mobile) -> /investors.html + /press/kit/; Next rebuilt + restarted PORT-safe. about.html: removed 4 garbled AI 'What's coming' dashboard images (hallucinated text) — clean number+title cards remain. Visual-inspection-confirmed junk removed.
homepagenavinvestorspressaboutimagesdone2026-06-13
CT-202 claude medium
Investors page: added PROJECTIONS & market-demand section (grounded in our research): 3-yr ARR Y1 $28K/Y2 $150K/Y3 $550K base w/ ranges (all tagged PROJECTED, $0 today stated), break-even ~117, + per-product demand table (price×margin×demand signal from AppSumo/category research) → bottom-up method, links to-the-numbers. Honest under-claim. Live+purged.
investorsprojectionsfinancialsdone2026-06-13
CT-203 claude medium
FIXED slider products-not-showing: shots 404'd via wrong relative path (../products/shots -> /products/shots 404). Fixed path + real <img> tags + device pulled on-screen. Verified: CloviPDF visible in laptop, newest cards show shots, 0 console 404s
clovisliderbugfixproductsverified2026-06-13
CT-204 claude medium
Investor Document Studio v1 BUILT: investor_doc_studio.py — purpose-driven export (one_pager/projections/valuation/exec_summary) -> LIGHT-themed, print/PDF-ready docs (white bg, CSS bar charts, KPIs, storytelling pull-quotes, brand color) from real data sources. Reuses founder_report light renderer; NO new agent needed — Discovery agent gathers, Doc Composer resolves purpose->sections, CloviPDF/CloviDecks for export formats. Design: docs-planning/INVESTOR_DOC_STUDIO.md. Live at founder-hq/docs/. Doc-type catalog (9 investor doc types) analyzed.
  • v1 DONE: 4 doc types (one_pager/exec_summary/projections/valuation) live + Founder HQ selector card (pick purpose -> open -> Export PDF). Light theme confirmed. Next: Discovery-agent exec types (data-room index/FAQ) + CloviDecks deck export + CloviPDF server-side PDF.
doc-studioinvestorpdfexportreports2026-06-13
CT-214 user medium
NEEDS YOU: add free Unsplash (UNSPLASH_ACCESS_KEY) + Pexels (PEXELS_API_KEY) keys to master.env so CloviVision can keyword-search stock images. Optional: Google Programmable Search cx (have GOOGLE_API_KEY, need cx) for Google image search.
  • RESOLVED via vitalwebmaster_wp DB (Aiomatic plugin): PEXELS_API_KEY + PIXABAY_API_KEY recovered, live-tested (200), stored in master.env. Unsplash only toggled on (no key) — needs free signup if wanted. CloviVision stock search now unblocked (Pexels+Pixabay).
needs-youimage-searchkeys2026-06-13
CT-215 claude medium
CloviOptimize (Optimization Agent) BUILT: self-learning drive-to-100 (Lighthouse), KB 37->52 (learns new audits), scan/plan/learn/apply_safe; real scores: how-it-works Perf49/A11y91/BP100/SEO100, recommendations SEO54 (is-crawlable blocked). Staged cron, registered clovioptimize
clovioptimizeoptimizationlighthouselearning-loop2026-06-13
CT-217 claude medium
REAL CES/CI award images placed: found CloviTek press-asset Drive folder (1M4JwR... ~50 files). Decoded + placed CloviTek-CES-2018-Innovation-Honoree.png (2558x1250, official CES badge + real device) + CloviTekCommerciaIntegrator2018Winner.jpg on wayback 2018-2019 era — replaced my composed badges. Folder also has ~40 real CloviFi product photos + Investors Choice + InfoComm banner + app screenshots = source for replacing AI device renders. Visual-inspected, confirmed correct.
waybackawardsreal-imagescesvisual-inspectiondone2026-06-13
CT-218 claude medium
Real CloviFi product photo placed on wayback + about: optimized clovifi-wireless-audio-transmitter-front.jpg (5760x3840 studio photo -> web 1400px/49KB) replaced the AI device renders. Visual-inspected + selected as best fit for the device slot (real photo > AI render; clean white-bg product card). Source: CloviTek press-asset Drive folder. ~40 more real photos available.
waybackaboutreal-imagesproduct-photovisual-inspectiondone2026-06-13
CT-219 claude medium
Wayback 2015-2017 strip = uniform clean real-photo cards: built 940x400 white cards (device front studio + device-on-TV cropped from real photos via PIL: contain+pad+sharpen) replacing AI renders; switched slots to cover for edge-to-edge consistency. Products fully recognizable (real photos, not AI-regenerated — designer call to avoid hallucination). Reusable card() treatment = the 'fit into boxes cleanly' pattern for CloviVision/CloviImage.
waybackimagesreal-photouniform-cardsdesignerdone2026-06-13
CT-220 claude medium
Slider polish DONE: clovicharts shot captured (no broken imgs), mobile phone shows app, global text>=14px+brighter, real logo, Ukrainian yellow+blue palette (blue glows+amber->blue gradient). + CloviOptimize extended w/ BERQ 11-step stack KB52->66 + SPEED_STRATEGY playbook + evolving learn loop
sliderpolishclovioptimizeberqukrainian2026-06-13
CT-222 claude medium
Slider phone mockups FIXED: 23 real mobile-viewport (390x844) screenshots captured, phone frames now show real mobile layout not cropped desktop
slidermobileshots2026-06-13
CT-226 claude medium
Homepage nav declutter DONE: removed crowding investor/press pills from top nav; added fixed right-edge SideRail (global, layout.tsx) w/ hover-label icons -> Investors/Press/Legal Advisor/Get-in-touch/Founder HQ. Confirmed CloviAble a11y widget already fixed bottom-left (z-index 2147483600, always-available, never scrolls) — no change needed. Rail z-40 right, widget bottom-left = no conflict.
homepagenavsiderailaccessibilityfounder-hqdone2026-06-13
CT-232 claude medium
CloviChat LIVE: /chat route wired, RAG bot answers public CloviTek Qs + REFUSES private (code/keys/IP/system-prompt) verified. CloviSlider embed CORS wired. Homepage-embed = coordinated follow-up (Next app)
clovichatclovicontactclovisliderlive2026-06-13
CT-236 claude medium
Homepage numbers: (1) REAL/HONEST pass — replaced fabricated/borrowed figures with measured counts: 47+->90+ agents (real ~98), 110+->100+ keys (real 103), 22+->65+ services (real 67 PM2), removed borrowed '2,674+ connectors' & '9,000+ app connections' (Zapier's) -> '247+ apps tracked' + '37 customer-facing platforms' (real); plugins '0+' guarded with floor. platforms.length/liveCount already live-API. (2) HeroStats VISUAL EFFECTS: overshoot count-up + glow pop on land + shimmer sweep across digits + pulsing live-dot + breathe; reduced-motion safe.
homepagenumbershonestyvisual-effectsherostatsdone2026-06-13
CT-237 claude medium
Homepage hero stat band: CSS-only visual effects applied to the INLINE stats (HeroStats component wasn't wired to homepage) — shimmer sweep across digits + breathing glow + pulsing live-dot on the 2 live-API numbers + staggered reveal-pop + hover-pop. Reduced-motion safe. Paired with the real-number honesty pass (90+/100+/65+/247+, borrowed 2674/9000 removed).
homepagevisual-effectsstatsdone2026-06-13
CT-261 claude medium
clovitek-site homepage+platforms UI: 12-cap + view-more CTA, category sections, keycap hover, knife-spark corners, Get Started attention effect, expanded footer — all LIVE
2026-06-13